SriBhagavatgita Part2 Chapter 10 to 18 in English by Kowta Markandeya Sastry



             Om SriKrishna ParaBrahmanenamah                          Sri Bhagavadgita
                  Atha Dasamodhyaayah(10th Chapter)                          Vibhootiyogah

SriBhagavaan uvaacha:
Bhooyaeva mahaabaahosrunume paramamvacha
Yatteham priyamaanaaya vakshyaami hitakaamyayaa 1
Sri Bhagavaan said:
Oh might armed Arjuna, you are very glad in hearing my rendition for your good. Now hear further My following renditions delivered by Me as your well wisher.   
Nameviduh suraganaah prabhavam namaharshayah
Ahamaadirhidevaanaam maharsheenaam cha sarvasah 2
Multitude of angels nor the sages cannot know my existence. I am the source of those angels and sages.   
This means they are not unaware of this. They pretend as though they are not aware.
The light rays from the projector are to be sent through the negative film. They have to strike the white cinema screen so that figures can appear. Here Time and Space is the screen. Maaya is the film. The effulgence of Parabrahman is light rays. The figures on the screen is Creation.
 Parents knowingly play hide and seek games for the  enjoyment of their children. Likewise the Great sages are aware of the duality of Maayaa. They enjoy it as the drama of Parabrahman.  
Yomaamajamanaadimcha vettiloka maheswaram
Asammodassamartyeshu sarvapaapaih pramuchyate  3
The sadhak who realizes Me to be of no birth, and origin, he is considered to be a man of pure wisdom. He is liberated from all sins.  
Buddhirgnaanamasammohah kshamaa satyam damassamah
SukhamDukkhamBhavobhaavoBhayamchaabhayamevacha 4
Ahimsaa samataa tushtistapodaanam yasoyasah
Bhavanti bhaavaa bhootaanaam matta eva pridhagvidhaah 5
Intellect(Buddhi), wisdom, lack of delusion, patience, truthfulness, inner and outer control of senses, happiness, misery, birth, death, fear, courage, non violence, contentment, penance, charity, fame, and infamy—these diverse states of  beings springs from Me alone as modifications of nature.
This means the good, bad, good-bad mixed qualities of man are caused by Parabrahman.  They are caused as per their respective Karma.
Hydrogen and Oxygen are invisible to the naked eye. These  two different airs with different atomic figuresand they combine together to form water which is too different from its constituents.    
Likewise the whole apparent Cosmos is manifested from Niraakara(formless) and Nirguna(qualityless) Parabrahman. This whole animated and inanimated Jagat came out of Maayaa. Sun rays are part and parcel of Sun. similarly Maayaa is the inherent quality of Parabrahman.
Maaya is the root cause of Creation. Maayaa is the part and parcel of Brahman. It cannot work independently without Brahman.
The yogi who recognizes the all pervading Brahman cannot find Maaya. The one who beholds Maaya as real cannot find Brahman behind it.
Maaya is of trigunas, Satwa, Rajas, and Tamas. The combination of this trinity is Maaya.
This Maaya is having several names. They are—Avidya, Avyaktam, Prakriti, Pralay, Pradhaanam, and Agnaanam.
Avidya=Ignorance,  Avyaktam= you can determine this as such,  Prakriti=it is manipulating all tatwas in creation,  Pralay=all things will dissolve in Maaya after the end of Kalpa,  Pradhaanam= Material cause(Dravya or upaadaana kaaran), Agnaanam= juxtaposed to wisdom.
When Brahman enters into tainted and inert Maaya, then it becomes activated.  
         





    
























Because of the presence of the Magnet, magnetic field exists. This field attracts iron nails or magnetic material.
Here Magnet=witness or Active Brahma.
Magnetic field= inert Maaya.
If the Brahman(Magnet) exists then only Inert Maaya
(Magnetic field) is manifested. Likewise the inert Maaya is the cause of Creation.
This Maaya is called as Yogamaaya, Chitsakti, Devi, Prakriti(Nature),  Moola agnaanam(Root ignorance), Moola Prakriti(Root Nature), Avidya(impure wisdom or knowledge).
If Satwaguna(Positive) is predominant in Maaya, then rest two gunaas, Rajas and Tamo, will be dormant.
The Creation is manifested out of Maaya which the integral part of Parabrahman. 
The water in the water bodies are vapourized due to Sun heat and are again merged into that water bodies in the form of rains.  So at the end of dissolution, the creation is merged into the Maaya and again reemerges out of it.
Maaya is a part of Brahman. The rest three parts are Nirguna Parabrahman.         
Maharshayassaptapoorve chatwaaromanavastathaa
Madbhaavaa maanasaajaataa yeshaam loka imaaprajaah 6
The seven Great Rishis are the progenitors of the mankind. The Primeval Four of Sanaka, sananda etc., fourteen Manus, with their Godly qualities, are born of My thought.
The whole Creation is manifested because of the presence of Sat, Parabrahman, which is beyond the creation.
From Sat only the God in Creation manifested. This is nothing but Omnipotent pure consciousness of Parabrahman. This only is manifested as Kootastha Chaitanya(Krishna Consciousness), Mahaaprakriti, and its six different consciousnesses viz.,
Samishti(Macro)Kaarana(Idea),
Vyashti(Micro) Kaarana,
Samishti(Macro)Sookshma(subtle),
Vyashti(Micro)Sookshma,
samishti(Macro)Sthoola(Physical),and
 Vyashti(Micro) Sthoola,
Saptamaharshis—Mahaprakriti, and all the above six consciousnesses together are called Saptarishis. They are named as Mareechi, Atri, Angeerasa, Pulaha, Kratu, Pulastya, and Vasishta.
Sanaka, Sanadana, Sanaatana, and Sanatkumaara are the mental offsprings or feelings or creations of Acting Brahma.
From them came out the rest of living beings. They can be described as Pure constructive Mahaprakriti of Parabrahman.
Sanaka = the first and foremost
Sananda = the one with happiness
Sanaatana = eternal
Sanatkumaara = ever youthful.
These four mentally conceived children produced by the acting Brahma with the mere power of will.  They are pure and innocent. They have not shown any inclination for offspring. 
But the combination of eternal happy Paramaatma and the happiness inherent in Mahaprakriti lead to three Gunas. These three Gunas are like stilled waters in a lake where one can clearly behold his face.
Rajoguna is having a catalyst quality of moving/vibrating or can move/vibrate. This has made the stilled Satwa(existent) and Tamo(destruction) gunas also to move/vibrate.
Rajoguna with its vibratory quality has become of creation and hence it is called Brahma, the Creator.
The existence quality of Satwa is Vishnu.
Destruction quality of Tamas is Siva.
Experiencing the thrill in different forms and internal happiness are the desires of Mahaprakriti.  This will superimpose four constructive ideas on these three Gunas, Satwa, Rajas, and Tamas.  They are—Vibrations(Spandana) (Ohm), Time (Kaala), Space(Desa), and Atom(Anu)( the idea of dividing One Parabrahman into many individual souls).
Manus are fourteen. They are:
Swayambhuva, Swaarochisha, Aouttami, Tamasa, Raivata, Chakshusa, Vaivaswata, Saavarni, Daksha saavarni, Brahma Saavarni, Dharma Saavarni, Rudra Saavarni, Rauchya or Deva saavarni, Bhautya or Indra saavarni.
Each Manu is the First citizen, Adipurusha, of each Manvantaram, the time period of Manu.
After each Manvantaram i.e., the completion of one Manu time period, there will be a dissolution. After completion of this dissolution, Pralay, it will usher to the next Manvantaram of another Manu.
Presently the Vaivaswanta Manvantaram, the time period of seventh Manu Vaivaswata is running.

Vaivaswata = effulgence, Manu = mind.
With this Manu(mind) only conscious man will emerge.                 
Etaam vibhootim yogam mamayovetti tattwatah
Sovikampena yogena yujyate naatra samsayah                  7
The sadhak who understands through his Kriyayoga practice, the true nature of My vibhootis, prolific manifestations, and dissolving power of my Divine Yoga which is beyond logic, he is unshakably attached to me. This is beyond any doubt.
Aham sarvasyaprabhavo mattah sarvam pravartate
Iti matwaa bhajante maam budhaa bhaavasamanvitaah 8
Iam the root cause of everything in this Cosmos, animated or inanimated. The whole Cosmos is running due to Parabrahman.—with this realization the men of pure wisdom are worshipping Me  awestricken.
Machchittaa madgata praanaabodhayantah parasparam
Kathayantascha maam nityam tushyanti cha ramanticha 9
They are fully absorbed in Me. Their life forces are surrendered to me through Pranayama. They are mutually discussing about Me. These sadhaks are completely satisfied and joyful. 
Teshaam satatayuktaanaam bhajataam preetipoorvakam
Dadaami buddhiyogam tam yena maamupayaantite        10
Those sadhaks are completely anchored to Me, and worshipping me with renewed love and affection. Iam giving purewisdom to such sadhaks.
Teshaamevaanukampaartha mahaamagnaajam tamah
Naasayaamyaatmabhaavastho gnaanadeepena bhaaswataa 11
To show compassion to those sadhaks, I Myself  dwell in their Antahkarana, and mitigating their obscurity with the light of Gnana, pure wisdom.
Arjuna uvaacha:
Parambrahma param dhaama pavitram parambhavaan
Purusham saaswatam divyamaadidevamajam vibhum     12
Aahustwaam rishassarve devarshirnaaradastathaa
Asitodevalovyaasa sswayam chaiva braveeshime          13
Arjun said:
He Krishna, You are Parabrahman, Supreme Shelter, Supreme Purity. All the Rishis(ascetics), the Divine saint Narada, Asita, Devala, and Vedavyaasa Maharshi are describing You as an Eternal One.  You are also describing Yourself as such to me.
Sarvametadyatammanye yanmaamvadsikesava
Nahite Bhagavan vyaktim vidurdevaanadaanavaah 14
He Krishna, Iam considering as Eternal Truth all You have revealed to me.  The Devas, and Asuraas(Titans) cannot know Your real identity.
The whole Cosmos is emerged out of Cosmic consciousness only. Devatas means wonderful subtle forces, and Asuraas means the most harmful subtle forces. Both of them cannot know Him.  
Devatas = The one who is having subtle and idea body but no physical body. He is man of virtue or virtuous bodies. Five panchamahatatwas, Air, Vaayu, Fire, Water, and Earth, are also called Devataas. They are the ones who help the beings for nourishment etc.
Asuraas = The one who is having subtle and idea body but no physical body. He is man of vice or sinful bodies.
 When these subtle forces can not know Him, then how an ordinary man can know Him.
Swayamevaatmanaatmanam veddhatwam purushottama
Bhootabhaavanabhootesa devadeva jagatpate                   15
Heh greatest among purushaas, Manifestator of all beings, the organizer of living beings, God of Gods, Lord of Cosmos, You only know Yourself. You cannot be known by others, You are impregnable.  
Vaktumarhasya seshena divyaahyaatma vibhootayah
Yaabhirvibhootibhirlokaani maamstwam vyaapyatishtasi 16
I wanted to hear completely about Your divine powers by which  You have pervaded these worlds.
Katham vidyaamaham yostwaam sadaa parichintayan
Keshu keshu cha bhaaveshu chintyosi bhagavanmayaa 17
Oh the yogi of yogis, How shall I always meditate to know You? Oh God, in what forms I can meditate on You?


That means shall we have to do sadhana on Nirguna Parabrahman, the infinite and formless with no Gunas?
                                                   Or
Shall we have to sadhana on Parabrahman with many forms, finite and with Gunas?
Vistarenaatmanoyogam vibhootimcha janaardana
Bhooyah kathayatruptirhi srunvatonaasti memrutam  18
He Krishna, Please expatiate in detail once again—the powers of Your Yoga, the things that I have to meditate, and Self-manifestations. I wanted to hear Your words imbued with nectar again and again as I am not contentede yet.

Sri Bhagavaan uvaacha:
Hantate kathayishyaami divyaahyaatmaa vibhootayah
Praadhaanyatah kurusreshta naastyanto vistarasyame        19
Sri Bhagavan said:
The greatest among Kurus, oh Arjun,  I will now tell you about some of My outstanding Divine powers as per their respective importance. My powers are infinite.
Ahamaatma gudaakesa sarvabhootaasayasthitah
Ahamaadischa madhyam bhootaanamanta evacha 20
Oh Arjun, Iam the soul of all beings. Iam the beginning, middle,  and end of all beings. I am the Generator, Operator, and Destroyer of all beings.
Gudaakesa = the one who has overcome sleep.
The sadhak who has become victorious over sleep i.e., Maayaa can only understand that Parabrahman is Everything, animated or inanimated.
MAHESWARASOOTRAANI:
Ayiun riluk e oy ai och hayavaraat lan nyamannanam jabhagadadas khaphacha tta dav kapay
With these sounds vowels(Achchus) and consonants(Hallus) and compounds of vowels and consonants are formed.
The subtle life force is having energy and consciousness both.  Its origin is Sahasraara chakra.
There are 49 upa vaayus or sub airs whose source is  subtle life force.
Every sub air is having its own respective peculiar duty. These duties are distributed through Agna chakra to Visuddha, Anaahata, Manipura, Swadhistaana, and Moolaadhaara, from these chakras to the nerve centres, and then to different organs.  

49 Maruths:
Adityaanaam aham Vishnur Jyothishaam Ravir Ansuman
Mareechir marutham asmi Nakshatraanaam Aham Sasi                    Gita 10---------21
Among the Adityas (12 effulgent beings), I am Vishnu; among luminaries, I am the radiating Sun; among the Maruths (49 wind Gods), I am Marichi; among heavenly bodies, I am the Moon.

vibratory element
Five pranas
Place
Reigning God
Action
Location
½ Aakaasha
Prana
Visista
Crystallization
Heart
½Vaayu

Apana
Viswakarma
Elimination
Anus
½ Agni

Vyana
Viswayoni
Circulation
All over the body
½ Water

Udana
Aja
Metabolizing
Gullet
½ Earth

Samana
Jaya
Assimilation
Navel
Sub Airs
Sub Airs
Sub Airs
Sub Airs
Sub Airs

Naaga

For belch
Gullet

Krukara


to sneeze
Nose

koorma

For movement of eyelids
Eyes

Devadatta

Yawning
Mouth

Dhananjaya

Keeps the body warm for 10 minutes even after death
All over the body

 Sri Sri Yogananda Swamiji has mentioned about 49 Maruths Chitram (Diagram) in God talks with Arjuna.
It is written in Sanskrit/ Bengali phrases. I tried to transliterate the same as much as possible. I may please be excused for any mistake committed by me.  
49 Maruths are divided into   7 chief category maruths. They are
1) aavaha, 2) Pravaha, 3) vivaha, 4) paraavaha, 5) udvaha, 6) samvaha & 7) Parivaha.
These maruths are existing within and without. That is the reason of relationship of existence among  Cosmos, Mind and Body. The ever existing Brahma is expressed in 49 Maruths. Lack of this wisdom is leading us to ignorance.
The 49 Maruths are:
   
1) pravaha Swaasini taana mahaabal  
2)Parivaha vihaga uddeeyaana rithavaaha  
3) Parivaha sapthaswara shabdasthithi  
4) Parivaha praana nimeelana bahirgamana thrisakra
5) Paraavaha maathariswaa anu satyajith   
6) Paraavaha Jagath praana brahmaritha  
7) Paraavaha pavamaana kriyaar paraavastha rithajith   
8) Paraavaha navapraana praanaroopo chitwahith dhaathaa 
9) Paraavaha hami moksha asthimithra  
10) Paraavaha saaranj nitya pathivaasa    
11) Paraavaha sthambhana sarvavyaapimitha   
12) pravaha  swasanaswaasa praswaasaadiindra 
13) pravaha sadaagathi gamaadau gathi   
14) pravaha pravadrisya sparsasakthi adrisyagathi    
15) pravaha gandhavaaha anushna aseetha eedriksha 
16) pravaha vaahachalavrithina
17) pravaha vegikaanthabhogakaama 
18) udwaha vyaana jrimbhana aakunchana prasaarana dwisakra 
19) aavaha  gandhavaha gandher anuke aane thrisakra
20) aavaha aasuga saighram adriksha  
21) aavaha maarutha bhittarer vaayu apaath
22) aavaha pavana pavana aparaajitha 
23) aavaha fanipriya oordhwagathi dhriva 
24) aavaha niswaasaka twagindriya vyaapi yuthirga 
25) aavaha udaana udgeerana sakrith 
26) parivaha anil anushna aseetha akshaya
27) parivaha samirana paschimer vaayu susena  
28) parivaha anushna seethasparsa pasadeeksha    
29) parivaha sukhaasa sukhadaa devadeva
30) vivaha vaathivyak sambhava
31) vivahapranathi dhaaranaa anamithra
32) vivaha prakampana kampana bheema
33) vivaha samaana poshana ekajyothi  
34) udvaha marutha uttaradiger vaayusenaa jith
35) udvaha nabhasthaana apamkaja abhiyuktha
36) udvaha dhunidhwaja aadimitha
37) udvaha kampanaa sechana dharthaa  
38) udvaha vaasa dehavyaapi vidhaarana
39) udvaha mriga vaahana vidyuth varana   
40)samvaha chamchala uthkshepana dwijyothi  
41) samvaha prushathaamapathi balam mahaabala  
42) samvaha apaana kshudhaakara adhogamana ekasakra
43) vivaha sparsana sparsa viraat  
44) vivaha vaatha thiryak gamana puraanahya  
45) vivaha prabhanjana manapruthak sumitha 
46) samvaha ajagath praana janma marana adrisya
47) samvaha aavak phlaa purimithra 
48) samvaha samira praatah kaaler vaayusanj mitha 
49) samvaha  prakampana gandher anuke aane mithaasana   

 Division:
A)
1) pravaha Swaasini taana mahaabal  
12) pravaha  swasanaswaasa praswaasaadiindra 
13) pravaha sadaagathi gamaadau gathi   
14) pravaha pravadrisya sparsasakthi adrisyagathi    
15) pravaha gandhavaaha anushna aseetha eedriksha 
16) pravaha vaahachalavrithina
17) pravaha vegikaanthabhogakaama                                                       7
B)
2)Parivaha vihaga uddeeyaana rithavaaha  
3) Parivaha sapthaswara shabdasthithi  
4) Parivaha praana nimeelana bahirgamana thrisakra
26) parivaha anil anushna aseetha akshaya
27) parivaha samirana paschimer vaayu susena  
28) parivaha anushna seethasparsa pasadeeksha    
29) parivaha sukhaasa sukhadaa devadeva                                                       7
C)      
5) Paraavaha maathariswaa anu satyajith   
6) Paraavaha Jagath praana brahmaritha  
7) Paraavaha pavamaana kriyaar paraavastha rithajith   
8) Paraavaha navapraana praanaroopo chitwahith dhaathaa 
9) Paraavaha hami moksha asthimithra  
10) Paraavaha saaranj nitya pathivaasa    
11) Paraavaha sthambhana sarvavyaapimitha                                                      7  

D)
18) udwaha vyaana jrimbhana aakunchana prasaarana dwisakra
34) udvaha marutha uttaradiger vaayusenaa jith
35) udvaha nabhasthaana apamkaja abhiyuktha
36) udvaha dhunidhwaja aadimitha
37) udvaha kampanaa sechana dharthaa  
38) udvaha vaasa dehavyaapi vidhaarana
39) udvaha mriga vaahana vidyuth varana                                          7     

E)
19) aavaha  gandhavaha gandher anuke aane thrisakra
20) aavaha aasuga saighram adriksha  
21) aavaha maarutha bhittarer vaayu apaath
22) aavaha pavana pavana aparaajitha 
23) aavaha fanipriya oordhwagathi dhriva 
24) aavaha niswaasaka twagindriya vyaapi yuthirga 
25) aavaha udaana udgeerana sakrith                                                         7
         
F)
30) vivaha vaathivyak sambhava
31) vivahapranathi dhaaranaa anamithra
32) vivaha prakampana kampana bheema
33) vivaha samaana poshana ekajyothi  
43) vivaha sparsana sparsa viraat  
44) vivaha vaatha thiryak gamana puraanahya  
45) vivaha prabhanjana manapruthak sumitha                                              7 
G)
40)samvaha chamchala uthkshepana dwijyothi  
41) samvaha prushathaamapathi balam mahaabala  
42) samvaha apaana kshudhaakara adhogamana ekasakra
46) samvaha ajagath praana janma marana adrisya
47) samvaha aavak phlaa purimithra 
48) samvaha samira praatah kaaler vaayusanj mitha 
49) samvaha  prakampana gandher anuke aane mithaasana                                  7   

Whatever Alphabets(Aksharaas) are there in SIX chakras all will be together exist in Sahasraara Chakra.
 Now whatever Vayu (Air) or Maruth exists in each Chakra(Plexus) is given individually:

A)Aagnaa    
1) pravaha Swaasini taana mahaabal   

B)Visuddha:
2)Parivaha vihaga uddeeyaana rithavaaha  
3) Parivaha sapthaswara shabdasthithi  
4) Parivaha praana nimeelana bahirgamana thrisakra
5) Paraavaha maathariswaa anu satyajith   
6) Paraavaha Jagath praana brahmaritha  
7) Paraavaha pavamaana kriyaar paraavastha rithajith   
8) Paraavaha navapraana praanaroopo chitwahith dhaathaa 
9) Paraavaha hami moksha asthimithra  
10) Paraavaha saaranj nitya pathivaasa    
11) Paraavaha sthambhana sarvavyaapimitha   
12) pravaha  swasanaswaasa praswaasaadiindra 
13) pravaha sadaagathi gamaadau gathi   
14) pravaha pravadrisya sparsasakthi adrisyagathi    
15) pravaha gandhavaaha anushna aseetha eedriksha 
16) pravaha vaahachalavrithina
17) pravaha vegikaanthabhogakaama

C)Anaahatha   
18) udwaha vyaana jrimbhana aakunchana prasaarana dwisakra 
19) aavaha  gandhavaha gandher anuke aane thrisakra
20) aavaha aasuga saighram adriksha  
21) aavaha maarutha bhittarer vaayu apaath
22) aavaha pavana pavana aparaajitha 
23) aavaha fanipriya oordhwagathi dhriva 
24) aavaha niswaasaka twagindriya vyaapi yuthirga 
25) aavaha udaana udgeerana sakrith 
26) parivaha anil anushna aseetha akshaya
27) parivaha samirana paschimer vaayu susena  
28) parivaha anushna seethasparsa pasadeeksha    
29) parivaha sukhaasa sukhadaa devadeva
D)Manipura    
30) vivaha vaathivyak sambhava
31) vivahapranathi dhaaranaa anamithra
32) vivaha prakampana kampana bheema
33) vivaha samaana poshana ekajyothi  
34) udvaha marutha uttaradiger vaayusenaa jith
35) udvaha nabhasthaana apamkaja abhiyuktha
36) udvaha dhunidhwaja aadimitha
37) udvaha kampanaa sechana dharthaa  
38) udvaha vaasa dehavyaapi vidhaarana
39) udvaha mriga vaahana vidyuth varana   


E)Swaadhisthaana   
40)samvaha chamchala uthkshepana dwijyothi  
41) samvaha prushathaamapathi balam mahaabala  
42) samvaha apaana kshudhaakara adhogamana ekasakra
43) vivaha sparsana sparsa viraat  
44) vivaha vaatha thiryak gamana puraanahya  
45) vivaha prabhanjana manapruthak sumitha 
        
F)Moolaadhaara
46) samvaha ajagath praana janma marana adrisya
47) samvaha aavak phlaa purimithra 
48) samvaha samira praatah kaaler vaayusanj mitha 
49) samvaha  prakampana gandher anuke aane mithaasana   


      
 



Mesha( Aeries), Vrishabha(Taurus), Mithuna (Gemini), Kataka(Cancer), Simha(leo), Kanya(Virgo), Tula(Libra), Vrischikam(Scorpio), Dhanussu(Saggitarus), Makara (Capricorn), Kumbha(Aquarius), and Meena(Pisces) are Twelve Rashis in ascending order. 
Sun will travel at the rate of one month in each and every Rashi. This travelling of sun in each and every Rashi is called Samkramanam. This way Sun will have twelve Samkramanams in one year.  These twelve ssamkramanams are twelve different effulgences or twelve different forms of Aditya. They are described as tweve Adityas. They are the sons of Aditi.
 They are:
1) Dhaata, (2) Mitru, (3) AAryamu, (4) Sakru, (5) Varunu, (6) Amsu, (7) Bhagu, (8) Vivaswantu, (9) Poosha, (10) Savita, (11) Twashta, (12) Vishnu.
India has been divided into several states to administer it. A Parliament consisting of Loksabha and Rajyasabha and a written constitution has been made.  The laws, rules and regulations are made after thorough discussions in both houses of Parliament.  To implement those laws one Central Cabinet headed by Prime Minister and council of Ministers will be there. To execute these laws through out the length and breadth of the country, there will be state legislative Assemblies, legislative councils, and Central and state Officers.
Likewise to adminster the Cosmos He has manifested Himself in different ways. as a part of His strategy His powers have been expatiated.
Different types of Airs are surrounding this Earth.  that way Praana, Apaana, Samaana, Vyaana, and Udaana Airs are formed. From these Airs are formed sub airs viz., Naaga, korma, Krikara, Devadatta, and Dhanaamjaya. From these another thrty nine sub airs are formed. That means our body consists of forty nine airs in total. The main Air is called Mareechi. Air is called Marut in Sanskrit.
Marichi is ine among Saptarishis, the seven important seers.
So the seven important Airs in human body are Saptarishis.
These seven important Airs have been transformed into forty nine sub airs as per their work.  
Naga Air = It exists in the gullet. Causes belchings.
Korma Air = It causes the movement of eyelids.
Krikara = Causes sneezings.
Devadatta = causes yawnings.
Dhananjaya = It exists in the whole body.  After the fall of the physical body it remains in the body for ten minutes and keeps the body warm even after the exit  of the life force
Vedaanaam saamavedosmi devaanaamasmi vaasavah
Indriyaanaam manaschaasmi bhootaanaamasmi chetanaa 22
Iam the Samaveda among Vedas, Vasava (Indra) among gods,  Manas (mind) among the senses, consciousness in creatures.  
Veda = to hear.            Saama = silence.  Anupoorva = to chant a sound in  a particular manner.  Sandhi = the rules that are to be followed while chanting compound words.  Sanaatana = chanting the letters in a systematic way.
The Om sound the sadhak hears in silence is Saamaveda.
Saama, Anupoorva,  Sandhi, and Sanaatana are very important in Saamaveda. This chanting will help the sadhak to go within. Every syllable has a speciality and transcendental vibratory effect.
The sadhak who made his senses as his slaves is Vaasava. That means he is Indra, the controller of senses. Mind is the king of senses. Mind will see, taste, and hear etc. everything is enjoyed and experienced by mind only. Mind is nothing but Subtle body, Sookshmasareera.
Na = don’t   halya = move.   Ahalya = na + halya.   Srirama = Cosmic consciousness, Paramaatma chetana.
Gautama is Saduru, the preceptor. Ahalya is his wife, and disciple. Her mind was not steady when Gautama was teaching Vedaant. Mind is Indra, the king of senses. Gautama orders her (Ahalya) to be steady and still like a stone so as to allow Cosmic conscious, Paramaatma chetana.  This is what Rama, Paramaatma chetana, touches Ahalya who is meditating with stone like steady minded body  in Tretayuga with feet.
Rudraanaam sankaraschaasmi vitteso yaksharakshasaam
 Vasoonaam paavakaschaasmi merussikharinaamaham 23
 Iam Sankara among Rudras, Iam Kubera among Yakshas and Rakshasas(demi-goblins),  Iam Agni(Fire) among Vasuvus,  and Meru among mountains.
Rudras eleven in number. They are:
Hara, Bahuroopa, Trayambaka, Aparaajita, Vrishaakapi, Sambhu, Kaparthi, Raivata, Mrigavyaadha, Soorya, and Kapaali.  
Mind, five sense organs, and five Karmendriyas together are called Ekaadasa Rudras.   Sankara is nothing but mind, the king of senses.
Ashtavasus are eight in number.  They are:
1) Dhara, (2)Dhruva, (3) Soma, (4) Ahu, (5) Anila, (6) Anala, (7) Pratyoosha, and (8) Prabhaasa.
In this intelligent and important forces, the eighth sakti, Prabhasa, purifier and giver of effulgence,  is important force.
 Tspinal cord is called Merudanda in Sanskrit. The top of spinal cord (Merudanda) is called Meru. The stem of this spinal cord is the kingdom of soul. Parabrahman is the form of Soul stays in cerebrum. He is the King of this kingdom. Through the spinal cord He will rule this kingdom.             
Purodhasaamcha mukhyam maamviddhi paartha brihaspatim
Senaaneemaha skanda ssarasaamasmi saagarah     24
Oh ArjunIam Brihaspati among priests,  Iam Skanda among army commanders, and ocean among lakes.
Brihaspati is called Brahmanaspati in Vedas. Through this Brahmanaspati only this creation abundance will be happening with the instrument of Maaya. He protects the Saadhaks, the meditators, from the spell of Maaya. He is representative of Sadgurus, the preceptors.
Skanda = The self control of Sadhaka.  This self control is the commander of Army.  
Narayana = The one who is all pervading.
Sesha = Constructive force.
Water = Panchamahabhootaas, Five electricities.
If the constructive force is combines with Panchamahabhootas, then it will lead to creation.  Ocean is the symbolic representation of infinity.

Maharsheenaam bhrugurahamgiraamasmyekamaksharam
Yagnaanaam japayagnosmi sthaavaraanaam himaalayah 25
He Arjun, Iam Maharshi Bhrigu among Maharshis(great sages), I am single syllable Omkar among the sounds, Iam Japayagna among Yagnas(sacrifices), and Himalaya among immovable things.
Maharshi = the liberated being.
Many Maharshis do not want to be entangled in this mundane circuit. Water cannot touch the lotus leaf. Similarly these Maharshis stay in this samsaar without any attachment and work for the sake of Parabrahman. Maharshi Bhrigu is such a Gnaani, the sage of wisdom.
The root cause of Creation is OM sound.
To have contact with God through Chanting of  OM is Japayagna.   
Aswatthah vrukshaanaam devarsheenaamcha naaradah
Gandharvaanaam chitrarathah siddhaanaam kapilomunih 26
Iam the Aswattha tree(holy fig tree) among trees, divine sage Narada among divine sages, Iam Chitraratha among Gandharvas(God like beings), and Kapila Muni among the Siddhaas(fully liberated beings). 
Man cannot survive solely on Physical food.  The Cosmic consciousness within and without is the prime need.
The roots of Aswattha tree are pointing towards sky. Likewise the hair in the head of man, nerves, medulla, subtle rays,  Antennae of Ideabody, shall get energy from Parabrahman only.
Naa rada = the one without body, intuition.
When man is in silent and pensive mood at some time or the other, then the sound of OM he hears is ME only. 
Chitraratha = the third in the Kootastha.
Kapilamuneendra = the chief among the makers of Sankhya philosophy.              
Uchchaisravasamaswaanaam viddhimaamamrutodbhavam
Airaavatam gajendraanaam naraanaamcha naraadhipam 27
Iam Uchchaisrava Horse born aliong with nectar, Airaavatam elephant among elephants, and king among the men.
Uchhaisravam = the upgoing Sravasa, life force.
The down going life force will make the man to move away farther and farther from Parabrahman, the man’s real form, and make him a slave to senses. he will be oblivious of “Aham Brahmaasmi”(Iam the God). 
Kriyayoga only will help him to bring back the down going life force to be upward. Through upward going life force through chakras, and Sushumna,  in Spinal cord,  man will transcend towards spirituality. This will make him to realize his real nature and meaning of taking human birth.
Airavatam means Elephant. Elephant is the symbol of intelligence. Even if a small thing on the ground can be seen by the elephant from a height with its small eyes and can lift it.
Airavata means East. The fore head of man is east which is a symbol of intelligence.
Raajaa means king. I am the king among men means king of yoga, Yogiraaj. The crown is kootastha. The king, Yogiraj, sits in kootastha, the place between the eye brows in the forehead.
Aayudhaanaamaham vajram dhenoonaamasmi kaamadhuk
Prajanaschaasmi kandarpah sarpaanaamasmi vaasukih 28
Iam the Vajrayudha weapon, Kaamadhenu Cow among the milching cows, Kandarpa or Manmadha(love god), the cause of righteous production of offspring,  and Vasuki among serpents.
The control of life force is Vajraayudha with which one can overcome Maaya.
The sadhak will fold his tongue back and put it into the gullet during Kriya yoga Sadhana. This is called Khechareemudra. This is called all giving Kaamadhenu.
When the outgoing Kunadlinee life force is in sleeping state, then it will excite the senses and make the man slave to lust.
 When Yogi awakens this kundalinee and make it inward and send it to Sahasrarachakra, then the same kundalinee force will aid him in transcendental Spiritual achievement. The upgoing Kundalinee life force through Sushumna subtle nadi is called Vasuki, the pure life force.
Anantaschaasmi naagaanaam varunoyaadasaamaham
Pitroonaamaryamaachaasmi yamassamyamataamaham 29
I am the Naga serpent among Naga serpents, Varuna among Jala devatas(gods), Aryamayi among ancestral parents, and I am Yama among the directors.
The Maaya in Creation is called Vasuki snake.
The Macro Maaya serpent is called Ananta, the infinite.  Bhagavan Vishnu will be resting on this Ananta serpent. Ananta  by itself is inert.  Vishnu, the God in creation, gives it consciousness.
Varuna is lord of Ocean. Waves come out of Ocean only. Likewise Parabrahman is the root cause of all manifestations.
Subtle Creation is the cause of Physical creation. Aryamayi is the constructive effulgence of subtle Creation. So He is the father of fathers.
Yama means self control. When time comes, the life force that sustains the physical body will be pulled out of it by Yama with tremendous discipline of self control.
Prahlaadaschaasmi daityaanaam
 kaalah kalayataamaham
Mrigaanaamcha mrigendroham
vainateyascha pakshinaam                30
Iam Prahlada among Asuraas, Time among measurers, lion among animals, and Garuda among birds.
One may be having Devish quality. If he does Kriyayoga sadhana with longevity and intensity, then that sadhak will be endowed with Hladam(happiness) and becomes Prahlaada, the one with happiness. 
We spend a many numbers of years, see a many number of places, and see a many number of wonders in our dream. All these are done in a limited period of time, say few seconds or minutes. Dream is dreamt beyond time and space. When we open our eyes, the dream disappears and we laugh heartily.
This Creation is also the dream of God.  We may be feeling Past, Present, and Future tenses but the creation is always a present tense to God, the Parabrahman.
Lion mates mating once in every three years. likewise the sadhak should control his lust and make his downward(Adhomukha) semen to move upward and make it Ordhwamukha.   
Bhagavan is Garuda bird among birds. When an important bird is Bhagavan, then all other small and sundry birds are alo Him only. That is the meaning.
Ga sound is the replica of  wisdom. Gnaanaaroodha = Ga rudha., So He is Garuda.
Pavanah pavataamasmi raamassastrabhritaamaham
Jhashaanaam makaraschaasmi srotasaamasmi jaahnavee  31
Iam the Air among the purifiers, Sri Ramachandra among weapon wearers, crocodile among fishes, and River Ganga among rivers.  
Kriyayoga will aid the sadhak in controlling the life force and make him united with Parabrahman. The cleanser of life force and make it pure is Parabrahman only.
Om chanting is a weapon that prevents the obstructions to Kriya yoga sadhana. This only one sound, ‘OM’ once uttered will not go waste.  This will continue to destroy all the negative forces in the Cosmos. 
OM is the replica of Parabrahman. Sriramachandra is also the replica of Parabrahman. The weapon of Sri Rama is Rambaan is nothing but OMKAR only. 
Desires are like fishes. Crocodile i.e., Parabrahman only eating our fish like desires in our Sadhana.
The Ganga, the soul wisdom, that is flowing through our Sushumna, is Parabrahman only.
Sargaanaamaadirantascha madhyamchaivaahamarjuna
Adhyaatmavidyaavidyaanaam vaadapravadaamaham 32
Oh Arjun, Iam the Generator, Operator, and Destroyer, of all manifestations. Iam Soul wisdom among all branches of knowledge, and Iam the discriminative logic. 
Aksharaanaamakaarosmi dwandvah saamaasikasyacha
Ahamevaakshayah kaalo dhaataaham viswatomukham 33
I am the first letter ‘A’ of all compounds, Dwandwa samaasa( connective element) among samaasaas, Time(Kaala) among Times(immutable time), and the sustainer and nourisher “Viraat Purusha’ of everything.  
Vowels and consonants constitutes Alphabets. Any consonant will be uttered with the aid of vowel only.
Pranava sabda OM constitutes combination of three letters, Akaara, Ukaara, and Makaara. The first letter ‘A’ is Parabrahman only.
The man and woman constitutes Dwandwa samaasa. Parabrahman is .the cause for righteous union of man and woman(dwandvasamaasa).    
Mrityussarvaharaschaahamudbha
vascha bhavishyataamaham
Keertissreervaakchanaareenaam
smritirmedhaa dhritih kshamaa               34
Iam the destroyer, Mrityu, of  everything.
Iam all devouring Mrityu, the Death, Manifestator of future creation also,  I am the divine seven qualities of Ladies—fame, prosperity, discernible  memory, memorable intellect,  courage, and patience.
Creation is Rajoguna, Sustenance (Sthiti) is Satwaguna and destruction(laya) is Tamoguna.  All these three are Parabrahman only.
Creation is Father quality, Sustenance is son quality. His dream or Maaya prakriti or Divyamaata(Divine Mother) is Stree quality, Lady. All the seven divine qualities of Divine Mother are His only.    
Brihatsaama tathaasaamnaam
 gaayatree chandasaamaham
Maasaanaam maargaseershoham
ritoonaam kusumaakarah                     35
Iam the Brihat-saman among Samaveda chanting, Iam poetic meters among Gayatree, Iam Maargaseersha maasa in months, and I am Kusumakara(Spring) among seasons. 
 Brihat = Great,  Saamam = Intellect, Great intellect is Parabrahman only.   
Dyootam chalayataamasmi tejastejaswinaamaham
Jayosmi vyavasaayosmi satwam sattwavataamaham  36
Iam the gambling in cheating in businesses, radiance of radiant, victory of the victorious, effort of the effortful, and positive quality of satwaguna people.
The Maaya of Paramaatma is the greatest gambling of all gamblings. Man is endowed with Ichchaasakti, will power, to overcome that. 
Vrishneenaam vaasudevosmi paandavaanaam dhananjayah
Muneenaamapyaham vyaasah kaveenaamusanaakavih 37
I am the Vasudeva, son of Vasudeva, of Vrushni dynasty, Arjun of Pandavas, Vedavyasa among Munis(saints), and Iam the Ushana among poets.
Dandodandayataamasmi
neetirasmi jigeeshitaam
Mounam chaivaasmi guhyaanaam
 gnaanam gnaanavataamaham          38
Iam the baton of the discipliners, Iam the victorious morality,
the silence of all secrets, wisdom of wisdom seekers.
One canescape from the justice of human court but no one can escape from the law of Karma enacted by Parabrahman. It is improbable. Paramaatma can be achieved in Silence only. God is found in silence. This is the real secret.
Yachchaapi sarvabhootaanaam beejam tadahamarjuna
Natadastivinaa yatsyaanmayaa bhootam charaacharam 39
Oh Arjun, Iam the root cause of all beings. There is nothing in this world, animated or inanimated, that can exist without Me.
Naantosti madivyaanaam vibhooteenaam parantapa
Eshatooddesatah prokto vibhootervistaromayaa      40
Oh scorcher of foes, there is no end to my manifestations. I had narrated concisely about some of my powers.
Yadyadvibhootimatsatwam sreemadoorjitamevavaa
Tattadevaava gachchatwam mamatejomsa sambhavam 41
In this world a thing or being which is prosperous, effulgent, active, and powerful, that thing is manifested out of a ray of my effulgence. Know this. 
Athavaa bahunaitena kim gnaatena tavaarjuna
Vishtabhyaahamidam kritsna mekaamsena sthitojagat 42
Oh Arjun, what more you needed than the things expatiated to you? This whole Cosmos is manifested out of a fragment of my Yoga power.
Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade   Vibhooti Yogonaama  Dasamodhyaayah(10th Chapter)

                               Aum, Tat, Sat.


             Om SriKrishna ParaBrahmanenamah                          Sri Bhagavadgita
                  Atha ekaadasodhyaayah(11th Chapter)                Viswaroopa samdarsan yogah           

Sri Arjuna uvaacha:
Madanugrahaaya paramam
guhyamadhyaatmasamgnitam
yattwayoktam vachastena
mohoyam vigatomama      1
Arjun said:
Oh Krishna, You have bestowed me with compassion the supreme secretive Soul wisdom. With your such preaching my delusion is completely banished.
Bhavaapayayau hi bhootaanaam srutau vistarasomayaa
Twattah kamalapatraaksha maahaatmyamapichaavyayam 2
O Lotus eyed Krishna, through You I have heard the beginning and end of all beings and of Your eternal powers in abundant detail.
Evame tadyathaatthatwamaatmaanam Parameswara
Drashtumichchaami teroopamaiswaram Purushottama   3
O Parameswar, the Master, I trust all the renditions of Yourself rendered by You fully. O Purushottama, the best and first among Purushas, I wanted to see Your divine embodiment now.
When the sadhana of Sadhak is intense, then he will be more and more interested in practically knowing God through Kriyayoga sadhana than the theoretical scriptural knowledge.  One should eat a fruit and know its taste than knowing through book reading. 
Manyase yaditachchakyam mayadrashtumiti prabho
Yogeswara tatome twam darsayaatmaanamavyayam  4
O Lord, if You feel that I am able to see that Great incarnation, O lord of Yogis, show me that decayless Macro incarnation of Yours. 
Now the intense Kriyayoga sadhak, Arjun, is inclined to attain the unity with his goal of attaining God.
Sri Bhagavan uvaacha:
Pasyamep Paartha roopaani satasotha sahasrasah
Naanaavidhaani divyaani naanaavarnaakruteenicha 5
Sri Bhagavaan said:
O son of Pritha, Arjun, see My different divine forms, Spiritual types which are not worldly, different forms in different colours, and infinite in number.
Pasyaadityaan vasoon rudraanasvinau marutastathaa
Bahoonyadrushta poorvaani pasyaascharyaani bhaarata. 6
O Arjun, see the suns, Vasus, Rudras, Aswinee Devataas, and Maruts. Likewise see the wonders which you have never witnessed.
Now the sadhak has obtained the eligibility clause of having done intense Kriyayoga sadhana. So Omnipresent Parabrahman  is showing His devotee His all pervasiveness. .
Ihaikastham jagatkrustnam pasyaadyasacharaacharam
Mamadehe gudaakesa yachchaanyaddrashtumichchasi  7
O Arjun,  see  this world, animated and inanimated, and what else you wanted to see also in Me at one place.
Paramaatma dwells in Kootastha. The Gnananetra, the third eye, of sadha is opened now due to his intense Kriyayoga sadhana. So Paramaatma is showing His Viswaroopam, the Cosmic embodied body Form.
Nachamaam sakyase drashtumanenaiva swachakshusha
Divyam dadaatime chakshuh pasyameyogamaiswaram  8
You cannot see My Cosmic Macro body with your naked eyes. I am presenting you the third eye. With that see My Yogic transcendental power.
During the intense Kriyayoga sadhana, the third eye of the sadhak will be opened. With that eye only the sadhak can behold the Yogic power of Parabrahman, the director of the Universes.    
Sanjaya uvaacha:
Evamuktwaa tato raajan mahaayogeswaro harih
Darsayaamaasa paarthaaya paramam roopamaiswaram   9
Sanjaya said:
O Dhritaraashtra Mahaaraajaa, this way the Great Yogi Srikrishna revealed to Arjuna His consummate Embodiment,  the Cosmic bodies Ishvara form.
Paramaatma will devour Maaya, the delusion, from Sadhaka, so He is named as Hari.
Anekavaktranayana manekaadbhuta darsanam
Anekadivyaabharanam divyaanekodyataayudham         10
Divyamaalyaambaradharam divyagandhaanulepanam
 Sarvaascharyamayam devamanantam viswatomukham 11
Bhagavan has shown His Macro incarnation consisting of infinite faces, eyes, several wonderous panoramic things, adorned with several divine jewels,  several divine raised weapons, divine flower garlands and clothes, besmeared with divine sandalwood pastes, full of marvel, effulgent, unending, and faces everywhere.  
Divisoorya sahasrasya bhavedyugapaduddhitaa
Yadibhaassadrusee saa syaadbhaasastasya mahaatmanah 12
If thousands of suns appeared simultaneously in the sky, their light is not equal to a fraction of the splendour of that Omnific Being.
 As a kriyayoga sadhak, I had practically experienced it.
Tatraikastham jagatkrutsnam pravibhaktamanekathaa
Apashyaddevadevasya sareere paandavastathaa         13
Then Arjun saw the entire Cosmos with diversified manifestations at one place in the gigantic body of Bhagavan Srikrishna.
This sthiti, status, is experienced by me during my intense sadhana. .
Tatah saa vismayaavishtohyashtaromaa dhananjayah
Pranamya sirasaa devam krutaanjalirabhaashata      14
Then that winner of wealth(Dhananjaya), with awestruck  hairraising wonder, bowed before Parabrahman with folded hands and said like this.
Dhananjaya = winner of Kriya yoga sadhana wealth
Arjun uvaacha:
Pasyaamidevaamstavadevadehe
sarvaam stathaa bhootavisesha sanghaan
brahmaanameesam kamalaasanastha
mrisheemscha sarvaasuragaamscha divyaan   15
arjun said:
Deva, I have seen all deities, animated and inanimated beings, the lotus seated acting Brahma, seven Rishis, and divine serpents, in your Cosmic body. 
Every human being will have the outgoing Kundalinee serpent force nearer to the Moolaadharachakra in the anus. When this kundalinee life force is going outward, it will make the man sense bound, and when it is going upwards to Sahasrarachakra through Merudanda, then it will unite Self with Spirit. It will be transformed into divine serpent.
Anekabaahoodaravaktranetram
pasyaamitwaam sarvatonantaroopam
naantam na madhyam na punastavaadim
pasyaami visweswaraviswaroopa  16
O Lord of the Cosmos, O embodied Cosmos, Iam finding You as having several hands, stomachs, faces, eyes, infinite formatted face.  I am unable to find Your beginning, middle, or end. 

Every cell in our body is a representative of ourselves. It can tell each and every detail of ours with DNA tests. Likewise We are the cells of the Cosmic body of Parabrahman.
 Kireetinam gadinam chakrinam
Tejoraasim sarvato deeptimantam
Pasyaamitwaam durnireekshyam samantaa
Ddeeptaanalankaara dyutimaprameyam     17
I am finding You as having worn crowns and truncheons everywhere, furious flame, as an abundant illumination, burning fire, and light of several suns, unlimited one, and as an intangible.
 Twamaksharam paramam veditavyam
Twamasya viswasya param nidhaanam
Twamavyayassaaswata dharmagopta
Sanaatanastwam purushomatome    18
You are only the subject of knowledge, the Supreme decayless Parabrahman, the basis of this Cosmos,  the protector of eternal Dharma, the righteousness, and You are the beginning.
This is the state of sadhak who is witnessing God practically with his intense sadhana.     
Anaadimadhyaantamanata manantaveerya
Manatabaahum sasisooryanetram
Pasyaamitwaam deeptahutaasavaktram
Swatejasaa viswamidam tapantam  19
I am seeing You as beginingless, endingless and of unlimitied abilities, with so many hands, with Sun and moon as Your eyes, and as a face of burning fire with flames coming out of Your mouth, and scorching the Cosmos with Your manifested brilliancy.
Dyaavaaprithivyomantaramhi
Vyaaptamtwayaikena disachasarvaah
Drushtaadbhutamroopamugrantavedam
Lokatrayam pravyathitam mahaatman   20
O mahatma, this whole earth and heaven, and all sides, are occupied by You only.  Also seeing Your ferocious and wonderous appearance, all the worlds are trembling with fear.
The Consciousness of Parabrahman is without any limit.
Aheemitwaam surasanghaavisanti
Kechidbheetaa prangalayo grunanti
Swasteetyuktwaa maharshi siddhasanghaa
Stuvanti twaam twaamstutibhih pushkalaabhih   21
These groups of Devataas are enering You. Some are euligiging You with folded hands. The concourses of Maharshis and Siddhas are eulogiging You with consummate prayers. 
Rudraadityaavasavoyecha saadhyaa
Viswesvinau marutaschoshmapaascha
Gandharva yakshaasura siddhasanghaa
Veekshante twaam vismitaaschaiva sarve         22
Rudras, Suns, Vasus, Saadhyaas(the one who does sadhana is saadhya), Viswedevataas(Rishis), Aswinee devatas (dualities of light and darkness), the groups of Gandharvas, Asuras, and Siddhaas, are beholding You with awe struck looks.
Roopam mahatte bahuvaktranetram
Mahaabaahobahubaahoorupaadam
Bahhodarambahudanshtra karaalam
Drushtwaalokaahpravyathitaastadaaham   23
O mighty armed Krishna, seeing Your fearful appearance, with so many faces, eyes, stomachs, fangs, all are fearing, I too am fearing.
Nabhah sprusam deeptamanekavarnam
Vyaattaananamdeepta visaalanetram
Drushtwaahitwaam pravyathitaantaraatmaa
Dhrutim navindaa misamanchavishno      24
O embodiment of Vishnu, seeing people are seeing with fear Your appearance as touching the sky, illuminating with effulgence, maultifarious colours, with mouths wide open, eyes burning with fire, and losing their courage and peace.
Danshtraakraalaanicha te mukhaani
drushtwaiva kaalaanalasannibhaani
disonajaane labhechasarma
praseeda devesa jagannivaasa                       25
O Vaasudevaa, Iam not getting happiness and wonder struck  seeing Your appearance adorned with ferocious fangs, resembling fire deluge. Be propitiated and merciful.
Ameechatwaam Dhrutaraashtrasya putraah
Sarvesahivaavanipaalasanghaih
Bheeshmadronassotaputrastathaasau
Sahaasmadeeyairapiyodhamukhyaih      26
Vaktraani te twaramaanaa visanti
Danshtraakaraalaani bhayaanakaani
Kechidvilagnaadasanaantareshu
Sandrusyante choornitai ruttaamaangaih        27
Iam seeing all these sons of Dhritarashtra, Bheeshma, Drona, Karna, all the groups of kings in Kaurava army, similarly the important soldiers and commanders in our army, are moving towards with haste,  and entering into your mouths with ferocious fangs. Some are entangling into Your teeth and appearing with faces with powdered.
 Yadaa nadeenaam bahavombuvegaa
Ssamudramevaabhimukhaadravanti
Tathaatavaamee naralokaveeraa
Visanti vaktraanyabhivijwalanti              28
The river waters flow towards ocean and finally merge into that.  Similarly the warriors and kings are hastily entering into Your mouths burning with flames.
Yathaa pradeeptam jwalanam patangaa
Vaisanti naasaaya samruddha vegaah
Tathaiva naasaaya visantilokaasta
Vaasi vaktraani samruddha vegaah            29
The creatures like gross hoppers etc enter into the burning fire. Likewise the men are also entering into Your mouths with renewed speed for death.
Lelihyasegrasamaanassamantaa
Llokaan samagraan vadanairjwaladbhih
Tejobhiraapoorya jagatsamagram
Bhaasastavograah pratapanti vishnoh        30
O Krishna, You are everywhere and devoring all with Your burning moths with flames. Your ferocious rays of light are pervading whole Cosmos.   
Aakhyaahi mekobhavaanugraroopo
Namostu te devavarapraseeda
Vignaatumichchaami bhavantamaadyam
Nahi prajaanaamitava pravruttim  31
The supreme God, tell me who are You wearing this gigantic body? I cound not understand Your Nature. I wanted to know thoroughly about You, Adipurusha, the first citizen. Salutations to You. Be merciful to me.  
Without knowing the strength and qualities of the opponents we ridicule as a matter of rule and habit, but when we understand his abilities we ask for pardon. Likewise the sadhak who has seen and practically experienced mighty powers and Forms of Parabrahman with his sadhana is asking for His pardon here.   
Sri Bhagavqan uvaacha:
Kaalosmi lokakshaya krutpravruddho
Lokaan samaahartumiha pravruttaha
Rutepitwaanabhavishyanti sarve
Evasthtaah pratyaneekeshu yodhaaha       32
Sri Bhagavaan said:
O Arjun, Iam the Yama, the Lord of     Death, and Iam existing in this world to kill the beings as such. The opponent warriors in this Kurukshetra war will die whether you do war or not irrespective of your existence. 
 Tasmaat twamuttistayasolabhaswajitwaa
Satroon bhuktwaraajyam samruddham
Mayaivete nihataah poorvameva
Nimittamaatram bhava savyasaachin         33
So O Arjun, get up, defeat the foes and get the fame. Enjoy the kingdom fully. These were already killed in the past by me. So, be instrumental in killing them.
The Omnipotent, the Omnipresent, and the Omniscient, God, will not have past, present, and Future. Everything is Present tense only to Him. If we read a 500 pages’novel then we will know what is there in page 300.  Likewise God knows everything about ourselves in the book written by Him.
Dronam cha Bheeshmamcha
Karnam tathaanyaanapiyodhaveeraan
Mayaahataamstwam jahimaavyadhishtaa
Yudhyaswa jetaasi ranesapatnaan   34
These great warriors viz., Drona, Bheeshma, Jayadradha, Karna, and other important commanders were already killed by me earlier. Just kill them for name sake. Don’t be afraid. Do war. You can be victorious.  
The novel reader will be burning with a desire,  ‘The man of vice should die.’ He has to completely read the 500 pages novel so that he will come to know that the villain of peace died at page 490.  This is the state of Sadhak who is hesitant to do the war because of the outcome of the war is unknown to him.  Parabrahman, our life writer, knew the outcome.
Sanjay uvaacha:
Etatchhrutwaa vachanam kesavasya
Krutaanjalirvepamaanah kireetee
Namaskrutwaa bhooyaevaaha keishnam
Sagadgadam bheeta bheetaha pranamya     35
Sanjay said:
Having heard these words from Srikrishna, shiveringly folding his hands with humility, Arjun said thus to Sri Krishna with lot of fear said to Krishna with quavering voice:
Arjun uvaacha:
Sthaane hrisheekesa tavaprakeertyaa
Jagatprahrushyatyanurajyate cha
Rakshaamsi bheetaani disodravanti
sarve namasyanticha siddhasanghaah 36
arjun said:
O Krishna, the Cosmos, Jagat, is very happy and delighted by uttering/chanting Your name and eulogizing Your powers. The demons are running hither and thither with lot of fear. The groups of Siddhaas are salutating You. These are adequate to Your Mahima, the Greatness.
Ksmaachchate nameranmahaatman
Gareeyase Brahmanopyaadikartre
Anantadevesa Jagannivaasa
Twamaksharam sadasattatparam yat             37
Mahatma, the Great Spirit, Deva of Devas, shelterer of Jagat, the Cosmos, You are the eternal Parabrahman. You are beyond Sat and Asat. You are beyond Physical, subtle and Idea worlds. You are the cause of Brahma, the Creator.  So it is not surprising to see the people paying their respects to You.
Twamaadidevah prushah puraana
Stwamasya viswasyaparam nidhaanam
Vettaasi vedyamchatathaamatwayaa
Tatam viswamanantaroopa     38
O the Inexhaustible one, Krishna, You are the Primal God, the Pristine Spirit,  You are the Final Refuge of the Worlds, the Knower  and Known, the Supreme Fulfilment. The whole Cosmos is pervaded by You.
Vaayuryamogni rvarunassasaankah
Prajaapatistwam Prapitaamahascha
Namonamastestu sahasrakrutwaha
Punaschabhooyopi namonamaste         39
You are Vaayu, the Air, Yama, the Lord of Death, Fire, Varuna, the Water God, Chandra, the mind God, Brahma, Creator, the Father of Brahma. Thousands of salutationws to You again and again.
Namah purstaadatha prushtataste
Namostute sarvataeva sarva
Anantaveeryaamitavikramastwam
Sarvam samaapnoshitatosi sarvah       40
O encompasser of all forms, Krishna, salutations to You in Your front, behind and all sides, intrinsically you have pervaded everywhere. You are of limitless abilities, and courage. You are of all forms.
Sakhetimatwaaprasabhamyaduktam
heKrishna he yaadava he sakheti
ajaanataa mahimaanantavedam
mayaapramaadaatpranayenavaapi       41 
yachchaapahaasaarthamasatkrutosi
vihaarasayyaasanabhojaneshu
ekothavaapyachyuta tatsamaksham
tatkshaamayetwaamahamaprameyam   42
O Imperishable Krishna, I had addressed You earlier as, ‘O Krishna, O yadava, and O friend. ’  This I had inadvertently addressed You during airings, sleeping, sitting, by mistake, during meals. without knowing Your powers. This type of undesirable addresses made by me when You are alone, or in the company of others, for being close to You. Kindly excuse my these unintentional insults as You are Incomprehensible.
Ordinary man blabbers about God whimsically. Finding God in his intense  Kriyayoga sadhana, he realizes the truth about the existence of God and then he begs His pardon. 
Pitaasi lokasya charaacharasyatwa
Masya poojyascha gururgareeyaan
Natwatsamostyabhyadhikah kutonyo
Lokatrayepyapratimaprabhaava          43
O unparalled Almighty, Krisha, You are the Father of this Cosmos, animated or inanimated. You are adorable.you are the Supreme Guru, the preceptor. No body can be equated with You in all the three worlds.how anyone can surpass You.  
Tasmaatpranamya pranidhaayakaayam
Prasaadayetwaamahameesameedyam
Pitevaputrasyasakhevasakhyuh priyah
Priyaayaarhasi devasodhum       44
So Iam putting my body before You in obeisance and prostrating before You with reverence as  adorable, and Lord of everything.  O Lord, pardon my mistakes like a father to his son, a friend to a friend, and a lover to his beloved.
 Adrushtapoorvam hrushitosmi drushtwaa
Bhayenacha pravyathitam mamome
Tadevamedarsaya devaroopam
Praseeda devesa jagannivaasa            45
Iam very happy to see such a Gigantic Appearance of Yours which I have never seen before, but my mind is very much perturbed due to fear. Be merciful to me, Deva of Devas, Sustainer of Worlds, and show me the earlier milder appearance. 
Kireetinam gadinam chakrahastamichchaa
Mitwaam drashtumahamtathaiva
Tenaiva roopena chaturbhujena
Sahasrabaaho bhava viswa moorte           46
O Krishna, I wanted see Your earler appearance with Truncheon, and Chakra(Discus). O Cosmic bodied, several armed God,  show me the earlier four armed appearance.
Sri Bhagavaan uvaacha:
Mayaaprasanne natavaarjunedam
Roopam Param darsitamaatmayogaat
 Tejomayam viswamanatamaadyam
Yanmetwadanye nadrushtapoorvam    47
Sri Bhagavaan said:
Arjun, I have shown My Viswaroop with my Yoga power to you with mercy which is Intrinsically Self effulgent, Universe-bodied, Unending, the Primeval One, and seen by none earlier except You, 
 Navedayagnaadyayai nairnadaanai
Rnachakriyaabhi rnatapobhirugraih
Evam roopassakya aham nruloke
Drashtum twadanyena kurupraveera.      48
O,the greatest among Kurus, Arjun, except you none else has seen this Viswaroopa(Macro appearance) earlier. You could see it due to my mercy. This Cosmic Form of Mine cannot be attained by reading of Scriptures, doing scriptural sacrifices, charities, or rigorous auster fire ceremonies.
This is possible only with intensive Kriyayogasadhana.
Matevyathaa maachavimoodhabhaavo drushtwaa
Roopamghora ghorameedyamgma medam
Vyavetabheeh preetamanaah punastwam
Tadevameroopa midam prapasya               49
Seeing My such Terrible Cosmic embodied Appearance, do not get frightened or stupefied.  Be brave and mild minded. Now you My earlier mild appearance thouroughly.
Sanjaya uvaacha:
Ityarjunam vaasudevastathoktwaa swa
Kamroopam darsayaamasa bhooyah
Aaswaasayaamaasa cha bheetamenam
Bhootwaa  Punassaumyava purmahaatmaa   50
Sanjay said:
O King Dhritaraashtra, having said this to Arjun, SriKrishna has shown His earlier Form to Arjun. Then He has consoled Arjun who was terrified.
O mind, blinded with delusion and attachment, get up, awake, and do Kriya yoga sadhana. Open your wisdom eye in the kootastha, the place between the eye brows in the fore head.
Arjun uvaacha:
Drushtwedam maanusham roopam tavasaumyam Janaardana
Idaaneemasmi samvrutta ssachetaah prakrutim gatah   51
Arjun said:
O SriKrishna, Now Iam passified seeing Your earlier Appearance of Man.  My mind is peaceful and gained my natural self.
Mother will take different forms to play with children.  Similarly the invincible and formless Parabrahman takes different Forms to assuage the fulfillment of His devotee.
Sri Bhagavaan uvaacha:
Sudurdasamidam roopam drushtavaanasi yanmama
Devaa apyasya roopasya nityam darsana kaankshinah 52
Sri Bhagavaan said:
The Form of Mine which you have seen is highly impossible to behold. Even the gods are eager to have a Darsan(Yearn) to see My Form.
It is possible only with Kriya yoga sadhana.
Naaham vedairna tapasaa nadaanena nachejyayaa
Sakyam evam drashtum drushtavaanasi maam yathaa 53
The Cosmic bodied Form seen by you, cannot be known by Vedas, penances, Charities, and Yagnas,
So the Yagnas with Himsa(Violence) are incompatible.
Bhaktyaa twananyayaa sakya ahamevam vidhorjuna
GnaatumDrashtumchaTattwenaPraveshtumChaParantapa 54
O the scorcher of enemies, Arjun, one can enter into Me with ANANYABHAKTI, incessant dedicated devotion. That Sadhak only will be able to know, see, and enter into me in fact.
That means the sadhak in his intense sadhana should burn his internal foes i.e., Kaama(desires-Duryodhana), Krodha (Anger- Dussaasana), Lobha(Greediness-Karna), Moha (illusion-Sakuni), Mada(Pride-Salya), and Maatsarya (Jealousy-Kritaverma). Then only he will get Ananyabhakti.
Matkarmakru nmatparamo madbhakta ssangavarjitah
Nirvairassarvabhooteshu yassamaameti paandavah      55
He who do the divine works for Me alone, who makes Me as his supreme goal, solely devoted to Me,  sheds his interest and attachments in physical attractive things of Nature,  who is not repulsive to other living beings, such sadhak is eligible to attain Me.
Man is made in the image of Parabrahman. Maaya will cover the real form of his and entangle him in Samsaar, Family. This Prakriti is His dream. This duality will one day vanish.
Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                   Viswaroopa samdarsan yogah ekaadasodhyaayah(11th Chapter)

                               Aum, Tat, Sat.

               Om SriKrishna ParaBrahmanenamah
                          Sri Bhagavadgita
             Atha Dwaadasodhyaahah(Twelth Chapter)
                               Bhaktiyogah
Sri Arjun Uvaacha:
Evam satatayuktaaye
bhaktaastwaam paryupaasate
Ye chaapyaksharamavyaktam
teshaam ke yogavittamaah        1
Arjun said:  
Those devotees who always fix their minds towards You and worship You, and those who worship the indestructible and intangible Parabrahman—which of these is better versed in Yoga.
Sri Bhagavan uvaacha:
Mayyavesyamanoyemaam nityayuktaa upaasate
Sraddhayaa parayovetaasteme yuktatamaa mataah        2
Sri Bhagavan said:
Those sadhaks who fix their minds on Me and worship me with incessant devotion and dedication, are the best yogis in My view.
The sadhak will be experiencing different samadhis(trances) during his sadhana. .
Moolaadhaara, swaadhistaana, and Manipura chakras are lower samsaara chakras.
Anaahata, Visuddha, Aagna, and Sahasraara are higher chakras.
Moolaadhara exists at the base of the Merudanda, spinal cord.  The outgoing kundalinee life force will be nearer to the Mooladhaara. It will have its hood down and tail wil be up in the higher chakras. 
Swadhistaana chakra will be 21/2 times of first gnot of Index finger above the moolaadhaara chakra.
Manipura is behind the navel in the spinal cord.
Anaahata is nearer to Heart in the spinal cord.
In the gullet visuddhachakra exists.Aagnaachakra exists in kootastha, the place between the eye brows on the fore head.
The trances the sadhak get in Moolaadhaara, swaadhishtaana, Manipura, and Anaahata chakraas are doubtful or sampragnaata samaadhis.
The trances the sadhak get in Visuddha, aagnaa, and sahasraara chakras are doubtridden or Asampragnaata samaadhis.
 Srikrishna shows fourteen worlds(lokas) to His Mother Yasoda. In that seven lokas exist within, and seven lokas exist without in each individual.
The lokas exist within each individual are Micro worlds or vyashti lokas.
The lokas exist without in each individual are Macro worlds or Samishti lokas. These are inclusive of individual.
Atala( Sahasraara), Vitala(aagnaa), Sutala(Visuddha), Rasaatala(Anaahata), Talaatala(Manipura), Mahaatala (Swaadhishtaana), and Paataala(Moolaadhaara), are Micro worlds, Vyashtilokaas.
Bhoo, Bhuvar, Suvar, Mahar, Jana, Tapo, and Satya are Macro worlds, Samishti lokas. These Samishti lokas include Vyashti lokas.
If one molecule of water consists of Hydrogen and Oxygen, then the whole ocean contains the same Hydrogen and Oxygen.
To know one is affected with Diabetes or not, there is no need to test the whole blood, and only one drop of blood is sufficient. 
One has to cleanse the Chakras and awaken the sleeping Kundalinee force with the practice of Kriyayoga, and make efforts to have ecstatic union with Parabrahman.
No one can become an Engineer or a Doctor in one day. One has to make 15 or 20 years of studious efforts. Likewise in a systematic way regular Kriyayoga sadhana is required to get ecstatic union with Parabrahman. 
Every chakra is having a particular Beejakshar(Root letter). The sadhak has to chant that particular Beejakshar pertinent to that respective chakra.  Then the sadhak will get different samaadhis in different chakras.
Yetwaksharamanirdesya mavyaktam paryupaasate
Sarvatra gamachintyamcha kootasthamachalam dhruvam 3
Samniyamyendriyagraamam  sarvatra samabuddhayah
Tepraapnuvanti maameva sarvabhootahiterataah     4
Those sadhaks who control their senses fully, and having evenmindedness, for the well being of all, do meditate on the Indescribable, Intangible to senses, Unshakable, Eternal, Omnipresent, and Indestructible Parabrahman, they attain Me. 
Sadhak will attain the God in Creation(Saguna Brahma) initially, and will attain God beyond Creation(Nirguna Brahma) at a latter state.   
Klesodhikatarasteshaama vyaktaasaktachetasaam
Avyaktaahi gatirdukkham dehavadbhiravaapyate  5
Those sadhaks who meditate on unmanifested Parabrahman, will have increasing difficulties in obtaining Him than the Manifested Parabrahman. This is because those who have not completely given up body attachment cannot get Me so easily.
An intelligent mathematician do not require pen and paper to do mathematical calculations. Similarly man is accustomed to name and form. So the sadhak in his sadhana keeps an Idol in front of him and meditate on it considering it as God in Creation. Afterwards he will do sadhana without any idol and meditate on God beyond creation.   
Yetusarvaani karmaani mayisannyasya matparaah
Ananyenaiva yogena maandhyaayanta upaasate        6
Teshaamaham samuddhartaa mrityusamsaarasagaraat
Bhavaami chiraatpaartha mayyaavesita chetasaam    7
O Arjun, those who completely surrender all their Karma(actions) to Me, consider Me as their only Goal, and meditate on Me with complete fixity of mind on Me—Iam rescuing very quickly such Yogis from this circuit of mundane existence.

In sadhana two things are to be remembered:
1)To do meditation at least at the rate of one minute per one year. If the sadhak is 62 years old, he must do at least 62 minutes meditation.
2) The intensity in Sadhana.
Mayyeva manaaadhatsya mayibuddhim nivesaya
Nivasishyasi mayyeva ataoordhvam na samsayah            8
Fix your mind completely on Me, enter your intellect on Me only, then you will live in Me eternally.undoubtedly.
Atha chittam samaadhaatum nasaknoshi mayisthiram
Abhyaasayogena tato maamichchaaptum dhananjaya 9
O Arjun, in case you don’t have the capability to have a fixity of mind on Me, then endeavour with renewed vigour to obtain that state and make efforts to attain Me.
Abhyaasepyasamarthosi matkarmaparamobhava
Madardhamapi karmaani kurvan siddhimavaapsyasi 10
In case of inability to do that practicing that single minded devotion on Me, then do all actions thinking Me in your mind. If you do Karma surrendering to Me then also you will get salvation.
Athai tadapyasaktosi kartum madyogamaasritah
Sarvakarmaphalatyaagam tatah kuru yataatmavaan  11
Even this cannot be done by you i.e., doing Karma fixing your mind on Me, then give up the results of all Karmas with steady mind.  
Sreyohi gnaanamabhyaasaat
gnaanaaddhyaanam visishyate
Dhyaanaatkarmaphalatyaaga
styaagaachchaanti ranantaram 12
Verily, wisdom gained from systematic Guru/scripture given Kriya yoga practice is  superior to mechanical Yoga practice.
Meditation is superior to theoretical scriptural wisdom.  The relinquishment of the fruits of  Karma is superior to the state of mind which is steady only during Meditation. Renunciation of fruits of such Karma will lead to quick amelioration of mind.
Adweshtaa sarvabhootaanaam maitrah karuna evacha
Nirmamo nirahamkaarah samadukkhasukhah kshamee 13
Santushtassatatam yogee yataatmaa drudhanischayah
Mayyarpitamanobuddhir yomadbhaktassamepriyah 14
The sadhak who is not having hatred on all beings, friendly and kind to all, devoid of ego and attachment, equanimity on happiness and misery, having patience, always contented, reglar in Kriyayoga practice, control minded, possessed of determination,  devoted to Me, and fully surrendered his mind and intellect to Me, is my favourite.  
Yasmaanno dwijate loko lokaanno dwijatecha yah
Harshaamarsha bhayodwegairmukto yassachamepriyah 15
The sadhak from whom people of the world are not afraid, and who himself is not afraid of the world,  who is free from happiness, anger, fear, and mental unevenness, is dearer to Me.
Anapekshassuchirdaksha udaaseeno gatavyathah
Sarvaarambhaparityaagee yobhaktassamepriyah     16
The sadhak who is free from desires, pure in body and mind, able worker, maintains neutrality, having no alarm and grief,  who has given up the responsibility of all works done by him, who has forsaken all ego-initiated desirable undertakings, who is single mindedly devoted to me—such a
 devotee is dear to Me.  .
Yonahrushyati nadweshti nasochati nakaankshati
Subhaasubhaparityaagee bhaktimaan yassamepriyah 17
The sadhak who is free from happiness, hatred, grief,  and who has given up good and bad, is dearer to Me.  
Samassatrau cha mitrecha tathaa maanavamaanayoh
Seetoshnasukhadukkheshu samassanga vivarjitah  18
Tulyanindaastutirmaubee santushtoyena kenachit
Aniketah sthiramatirbhakti maanme priyonarah 19
The sadhak who is having equal mindedness towards friend, foe, insults and praises, cold and heat, happiness and grief, not having any interest in desires, not bothering blame and eulogy, not having mind inclined attachments, who maintains calm and quietness, gets contented with whatever he gets,  not interested in acquiring own houses, wandering quality with no attraction towards staying in a particular fixed place , determination, and completely devoted to me, is dearer to me.   
Yetudharmyaamrutamidam yathoktam paryupaasate
Sraddhadhanaamatparamaa bhaktaasteteevame priyaah 20
But those sadhaks who are dedicated and trust Me only, mind anchored to Me,  pursue with this nectar-like, salvation providing Dharma –sucha a devotee is extremely dearer to Me.

Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                    Bhaktiyogonaama Dwaadasodhyaahah(Twelth Chapter)

                               Aum, Tat, Sat.

             Om SriKrishna ParaBrahmanenamah
                          Sri Bhagavadgita
             Atha trayodasodhyaayah(13th chapter)
             kshetrakshetragnavibhaagayogah                
Sri Arjun Uvaacha:
Prakritim purshamchaiva kshetram kshetragnamevacha
Etadweditumichchaami gnaanam gneyam cha kesava  1
Arjun said:
O Krishna, I wanted to know what is Prakriti, Purusha, Kshetram, Kshetragna, Gnaanam, and Gneyam.
Sri Bhagavan uvaacha:
Idam sareeram kaunteya kshetramityabhideeyate
Etadyovetti tam praahuh khetragna iti tadvidah     2 
Sri Bhagavan said:
O son of Kunti, This Body is called Kshetram, knower of this body is called Kshetragna.  This is what is said by the learned.
The characters in Mahabharat are symbolic. Doorvaasa is Muni, sage, of anger. He preaches one mantra to Kunti. Kunti is the replica of self-control and dispassion, vairagya. She wanted to test the veracity of that Mantra. Kunti is testing the veracity of the Mantra. This indicates the decline of  Vairagya or self-control in her. 
Nothing can be done without the presence of Cosmic consciousness. Even man’s consciousness is the stepped down Cosmic consciousness only ultimately. Sun represents Cosmic consciousness. Self control is the ambit of  Manipura chakra. The combination of Cosmic consciousness and declined self control is the result of birth of Karna, representing raga dwesha, attraction and repulsion.      
Kshetragnamchaapi maam viddhi
sarvakshetreshu bharata
Kshetrakshetraganyorgnaanam
yattam gnaanam matam mama               3
O Arjun,  you know Me as Kshetrgna, Dweller, of all body fields. The knowledge of this Kshetra and Kshetragna is real Gnana, wisdom.  
Tatkshetramyachcha yaadrukcha yadvikaarayatascha yat
Sachayotprabhaavascha yatpramaasena me srunu       4
What is that body field, its different manifestations,where from it manifested, in what way it is manifested, who is Kshetragna, what influence Kshetragna manifests—listen to Me all these things briefly.
The Mahabharat war is the war between, virtue and vice, divinity and demonity, Paraa prakriti and Aparaa prakriti, Cosmic Consciousness and human consciousness.
Man is bound by Karma but he is given will power, Ichchaasakti, to cross the barrier between ParaaPrakriti(Cosmic consciousness) and Maaya(human consciousness). This war is eternal.
 Animal cannot get Brahman by doing Dhyana, meditation. Animal is not bound by Karma. Man only is bound by Karma. In fact man has to take the birth of lower animals to experience his karma done by him.  Man has to walk in the path given by his Soul without succumbing to desires and habits. This is his bounden duty.
What has been taught in Gita is nothing but the Soul guidance, Aatmabodha, he is getting through his intuition.
Arjuna means Sadhak. If we subjugate to Karma then we will be bound by bondage, hearing to Soul guidance will lead to liberty. 
Man has got liberty before doing any work, but after doing work he will be bound by the results of that Karma whether he wills it or not. That karma haunts him. This is what is called Karmasiddhaanta, principle of Karma.
If man contemplates he can get liberation at once. Liberation depends upon the victories within than without. 
Will power is independent of the past or present habits or karma. It is independent of subjugation to mental passions. It should be properly utilized by following the path and guidance given by Sadguru, the preceptor,  lest it is a wastage of the faculty misutilized by the man.    
Desires, greediness, difficulties, and intricacies are the chain with which the Soul is bound with the body.  Then the pure soul is called Jeeva.
With the vigorous Kriyayoga sadhana this shackles can be broken and gets liberation.
Rushibhirbahudaa geetam chandobhirvithaih pruthak
Brahmasootrapadaischaiva hetumadbhirvinischitaih 5
The knowledge of Kshetra and Kshetra has been proposed by the Rushis through four Vedas in different ways. and It is also proposed with illustrations by Brahmasootravaakyas logically.   
When Prakriti is manifested out of Parabrahman, it will be pure, intangible, and unmanifested. This unmanifested Prakriti is named as Paraprakriti. This Paraprakriti has several synonymes. They are: maaya, sabda, paraasakti, prakriti, Mahaprakriti, Moolaprakriti, Kaali, Durga, and Mahaamaaya etc.
Paraprakriti with its three Gunas, Satwa, Rajas, and Tamo, hide the real nature of Parabrahman, and will emerge as tangible, impure, and, manifested Prakriti.  This is called Aparaprakriti.
Parabrahman beyond Creation and in Creation, both will be referred as Purusha.
Manmohan may be an individual. He is referred as husband of some one, brother of some one, Doctor, Engineer, or Manager etc. likewise the God beyond Creation is referred as Paraapurusha, eeswara, and Parabrahman.
The God in creation is referred as Kootastha purusha, and  Krishna Consciousness.
The pure individual Soul in Man is the integral part of Spirit only. Rishis, Munis, Yogis and Sadgurus are the pure souls. They are the representatives of Parabrahman.  They incarnate to give direction to us.
With the influence of senses, Suddhaatma will be subjected to body attachment and hence become impure Jeevaatma. 
Satwa, rajas, and Tamas Gunas are the cause of man’s Idea, subtle, and physical bodies.
Physical body will have 24 tatwas. 
Mano(wavering mind),  Buddhi( determined intellect), Chitta(feelings), and Ahamkaar(ego)—4, 
Five pranas, five sense organs,and pancha karmendriyas, total 19 tatwas, together constitutes subtle body. 
Subtle body, sookshma sareera, consists of 24 tatwas.
Karanasareera , Idea body, consists of 24+19 = 43 Tatwas.
Death will not give salvation to impure soul, Jeevaatma. After death, the jeeva with subtle and idea bodies will travel in astral field. With the practice of Kriya yoga, both subtle and Idea bodies also will be liberated. For this some time is required.
Mahaabhootaanyahamkaaro buddhiravyaktamevacha
Indriyaanidasaikamcha Panchendriyagocharaah  6
Ichchaadweshassukhamdukkham sanghaataschetanaa dhrutih
Etatkshetram samaasena savikaaramudaahrutam     7
Pancha Mahabhootaas(Five electricities), ego(Ahamkaar), Intellect(Buddhi), the Primal Nature(Moola Prakriti), Ten Senses(five Gnanendriyas, and five Karmendriyas), five Indriyavishayas, i.e., Sabda(Sound), Sparsa(Touch), Roopa (seeing), Rasa(taste), and Gandha(smell), desire, hatred, happiness, grief, the concourse of Body and Indriyas(senses), knowledge of profession, and courage—the conglomeration and conglutination of these things is what is called Body, Kshetram, has been succinctly explained.
Amaanitwa madambhitwamahaimsaa kshaantiraarjavam
Aacharyopaasanam saucham sthairamaatmavinigrahah 8
Indriyaardheshu vairaagyamanahamkaara eva cha
Janmamrutyu jaraavyaadhi dukkhadoshaanudarsanam   9
Aasaktiranabhishwangah putradaaragruhaadishu
Nityamchasamachittatwa mishtaa nishtopapattishu        10
Mayichaananyayogena bhaktiravyabhichaarinee
Viviktadesasevitwa maratirjanasamsadi                           11
Adhyaatmagnaana nityatwam tattwagnaanaardha darsanam
Etagnaanamitiprokta magnaanam yadatonyathaa           12

Not indulging in self-praise, not boasting, not doing any harm to other living beings with mind and body(so sacrifing dumb animals is wrong), having patience, maintaing purity, following steadily the righteous path of salvation, having sel-control, impaasionate to the objects of senses, egolessness, remembering repeatedly about the misery and faults caused by birth, death, oldage, and disease,  not having any undue interest and attachment in offspring, spouse, and immovable properties like House(eeshanatrayam) etc., equanimity in interested and uninterested things, auspicious and inauspicious things that might happen, incessant devotion on Parabrahman, confining to solitary places, not having interest in concourses of public, interest in Transcendental spiritual knowledge, remain anchored to Soul, knowing the Great use of Tatwagnaan(I am Parabrahman)—all this is pure wisdom, and juxtaposed is impure wisdom.
Gneyam yattatpravakshyaami yagnaatwaamrutamasnute
 Anaadimatparam brahma nasattannaasaduchyate        13
I will tell You indetail of That which is to be known, because such knowledge bestows immortality. The One which has beginingless cannot be descrbed as Sat or Asat.
Sarvatah paanipaadam tatsarvatokshisiromukham
Sarvatah srutimalloke sarvamaavrutya tishtati                14
Parabrahman is pervaded in all worlds encompassing with hands, eyes, heads, faces, and ears everywhere.  
Sarvendriya gunaavbhaasam Sarvendriya vivarjitam
Aasaktam sarvabhruchchaiva nirgunam gunabhoktrucha 15
Bahirantascha bhootaanaa
macharam charamevacha
Sookshmaatwaattadi vigneyam
doorastham chaantikechatat                   16
avibhaktamcha bhooteshu vibhasthimivachasthitam
bhootabhartrucha tagneyam grasishnu prabhavishnucha 17
jyotishaamapitajjyoti stamasah paramuchyate
gnaanam gneyam gnaanagamyam hrudisarvasya vishtitam 18 



The Parabrahman is the only thing to be known. This is shining all the sense faculties, yet transcending the senses, It itself is not having any senses, It is unattached, sustainer of everything,  not having any Gunas(Satwa, Rajas, and Tamo), It exists within and without of beings, It is Movable and unmovable,  cannot be grasped by ignorant as it is very very subtle, It is nearer and also farther,  It is indivisible but appears to be divisible among the living beings, manifests the beings, sustains, and destroy them.
And it is the Light of all Lights, Light of Suns and Moons, It is different and beyond from Ignorant Tamas, embodiment of pure wisdom, embodiment of bliss, the only thing that is to be Known, has to be attained with Pure wisdom, and is said to be the Dweller of all hearts.
Iti kshetram tathaa gneyam gneyamchoktam samaasatah
Madbhaktaetadvignaaya madbhaavaayopapadyate  19
In this way Kshetrem(Body field), and likewise Gneyam(the only Thing that is to be known) has been briefly described. My devotee will be able to attain Me learning/knowing this Great knowledge.
Parakrutim purushamchaiva
viddhyanaadee ubhaavapi
VikaaraamschaGunaamschaiva
ViddhiPrakrutiSambhavaan        20
O Arjun, know that Prakriti and Purusha, both as having beginningless. Mind, intellect, senses etc., Satwa, Rajas, and Tamo Gunas, are all borne out of Nature. 
Kaaryakaaranakartrutwa hetuh rakrutiruchyate
Purushasukhadukkhaanaa bhoktrutwe heturuchyate        21
In the Creation of the effect(the body) and the instrument(the senses), Prakriti(Nature) is spokenof as Cause; and Purusha is cause of experiencing joy and sorrow.
Prusha prakrutisthohi bhunkte prakrutijaangunaan
Kaaranam gunasamgosya sadasadyonijanmasu        22
Being in the  Prakriti, He is experiencing the joy and sorrow gunas borne out of Nature. Attachment to the three qualities of Nature causes the soul to take embodiment in good and evil wombs.        
Upadrashtaanumantaacha bhartaabhoktaa maheswarah
Paramaatmetichaapyukto dehesminpurushah parah   23
Purusha in spite of existing in this body, but He is different from the body, witness, the Consenter, Beholder, Experiencer, Parabrahman, and the Supreme Lord.
Yaevam vettipurusham prakrutimchagunaissaha
Sarvathaa vartamaanopi nasa bhooyobhijaayate       24
Who so ever sadhak is in this way knowing this Purusha, the Supreme Spirit,  and the three fold nature of Prakriti, will be free from rebirths in whatever form he exists.  
Dhyaanenaatmani pasyanti kechidaatmanamaatmanaa
Anye saamkhyena yogena karmayogenachaapare       25
Some sadhaks are beholding the Soul within themselves with pure mind through Dhyana yoga, some are finding IT through Sankhyayoga, and some are experiencing through Nishkaama karma yoga, doing karma and disowning its results.
Karma, Bhakti, Dhyaana, and Gnaana yogas are not independent. They are interdependent. They are gradual steps of Sadhana.
 Doing Karma lead to Bhakti, dedication. Dedication, Bhakti, leads to Dhyaana, one pointedness. Dhyaana will lead to Gnana, wisdom, and then salvation.
To make unsteady life force steady in Kootastha is called OORDHWA RETAS.
Impure soul, Jeeva, will see this samasaara Jagat through the Life force, Intellect, mind, and eyes. This Jeeva should relinquish this mundane world, and should turn towards Kootastha, Aagna positive chakra. If sadhak makes the habit of looking through kootastha, then the Spiritual transcedency is possible.
The culmination of the karmas of the past births will result in the present predicament of Jeeva.  Daiva sakti, the Soul strength, is undoubtedly Great, but nothing can be attained without Purushaakaara, self effort. God is beyond logic.
Without Karma, one cannot obtain knowledge.  Soul wisdom cannot be obtained without Praanaayaama karma.      
Anyetwevaamajaanantah srutwaanebhyah upaasate
Tepichaatirantyetyeva mrutyum srutiparaayanaah        26
Some are unable to grasp this Meditation, and Saankhya yoga, the path of knowledge. They are listening about IT through some learned and then following IT.  Those listeners are also becoming free from this circuit of mundane existence.   
Theoritical knowledge, or recitation of scriptures, shall not give us the knowledge of work.  One ounce of Practice is superior to one ton of practice. The namesake Poojas,  vratas etc shall not give us the dedication. The natural attraction and dedication will be obtained by doing Kriyayoga sadhana which is practical.  Without this natural attraction,  the feeling of suurendering  fully to God does not exist. This incessant bhakti feeling or pure wisdom the sadhak can attain Parabrahman.
If mind has to be made steady, then the unsteady life force has to be made steady. If life force has to be made steady, then the unsteady  mind has to be made steady. Mind and life force are complimentary to each other.
When unsteady life force becomes steady through Kriya yoga pranaayaama practice, then there exists the absence of Ida, Pingala, and Sushumna. That means there exists the absence of three Gunas, Satwa, Rajas, and Tamas. This state is called Kriyaateeta Avastha. This is the personifiacation of Gnaana, the merger of soul into Spirit.
Veda = to hear the auspicious sound of OM.
Antam = to get united with Parabrahman.
Vedantam means getting united with Parabrahman through the hearing of sound of OM.
After hearing a sound, the sound that is to be heard will end. Then there is nothing to be heard.  Likewise after attaining the God, there is nothing remains for the sadhak, the thing that is  not to be learnt or anything to learn.                 
Yaavatsamjaayate kinchitsattwam sthaavarajangamam
kshetrakshetragnaSamyogaattadwiddhiBharatarshabha 27
O the best among Bharatas, Arjun, whatever animated or inanimated thing that exists in this Cosmos, it is manifested with the union of Kshetra and kshetragna.
Kshetra = Prakriti,    Kshetragna = Supre Spirit. 
Samamsarveshu bhooteshu tishtantam parameswaram
Vinasyatswa vinasyantam yah pasyati sa pasyati    28
I am the Spirit and exists equally in all the beings. Iam imperishable even if the physical body dies. The sadhak who sees me as such is really seeing and he is really intelligent.
Samam pasyanhi sarvatra samavasthita meeswaram
Nahinastyaatmanaatmaanam tatoyaati paraamgatim 29
Because when the sadhak sees the Parabrahman equally  spread and existing in all the beings, the sadhak cannot torture or maltreat his own self. Such sadhak is getting the supreme transcendental state.
Prakruttyaivacha karmaani kriyamaanaani sarvasah
Yah pasyati tathaatmaana makartaaram sa pasyati     30 
Prakriti is responsible for all the karmas done by the men.  The Soul is not the doer.  The sadhak who understands this is real knower.  
Yadaa bhoota pruthagbhaava mekasthamanu pasyati
Tata evacha vistaaram brahma sampadyate tadaa  31
When one sees the all different beings of the world as existing in One Spirit, and visualizes those different beings are being manifested and spreading out differently fro that One Spirit,  then that sadhak attainsw Brahman and becomes Brahma himself.   
Anaaditwaan nirgunatwaat paramaatamaa yamavyayah
Sareerasthopi kaunteya nakaroti nalipyate              32
O Arjun, Parabrahman is causeless, beginningless, and untouchable by Gunas, Satwa, Rajas, and Tamo. So in spite existing in the Body, He is Undoer, and Untouchable by anything in the Nature. He is beyond everything.
Soul by itself is pure.it appears apparently in the guise of Physical, subtle, and Idea bodies. Likewise the God in Creation apparently wears the robes of Physical, subtle, and Idea bodies.
As a Macro Physical Cosmos Creator, He will wear the robes of Virat,  and as Micro Physical Cosmos Creator, He will wear the robes of Viswa.
As a Macro Subtle Cosmos Creator, He will wear the robes of Hiranyagarbha,  and as Micro Subtle Cosmos Creator, He will wear the robes of Tejasa.
As a Macro Idea Cosmos Creator, He will wear the robes of Eeswar,  and as Micro Idea Cosmos Creator, He will wear the robes of Pragna..
Yathaasarvagatam saukshmyaadaakaasam nopalipyate
Sarvatraavasthito dehe tathaatmaa nopalipyate             33
The sky is subtle and spreads everywhere. It is not tangible by dust etc because of its subtility. Likewise the Paramaatma, the indweller of the body and Nature, is intangible to faults and Gunas of the body.
Yathaaprakaasaayatyekah krutsam lokamimam ravih
Kshetram kshetree tathaakrutsnam prakaasayati bhaarata 34 
The sun alone is giving light or illumination to the whole world. Likewise the Parabrahman, Kshetragna, the in dweller of field, is illuminating the whole field, Nature and body.
Kshetrakshetragnayoreva mantaram gnaanachakshushaa
Bhootaprakrutimokshamcha yeviduryaantiteparam   35
Those who with this knowledge of insight, understand the difference between Kshetra and Kshetragna, and those who perceive the procedure of liberation from Prakriti, will enter the Solitude, the abode of Paramaatma.
During Sadhana the awakened Kundalinee of the Sadhak will cross the Brahma Grandhi spreading from Moolaadhara chakra to Manipurachakra. This is called Brahmagrandhi vichchedana. This will make the sadhak to cross the samsaarachakras or lower chakras. Crossing lower chakras is Karmakaanda. This is Kurukshetra, Rigveda kaal, Rigveda time.
In sadhana crossing the Rudragrandhi spreading from Manipurachakra to Visuddha chakra.  Rudragrandhi vichchedana is Upaasanaakanda.  This is Kurukshetra-Dharmakshetra, Yajurveda kaal, Yajurveda time. 
In sadhana crossing the Vishnugrandhi spreading from Visuddhachakra to. Sahasraarachakra. Vishnugrandhi vichchedana is Gnaanaakanda.  This is  Dharmakshetra, Saamaveda kaal, Saamaveda time.  After Vishnugrandhi vichchedana the auspicious OM sound is heard by Sadhak which is called Saamaveda gaana. Its end is salvation.

Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                    kshetrakshetragnavibhaagayogonaama trayodasodhyaayah (13th chapter)
                               Aum, Tat, Sat.


  
              Om SriKrishna ParaBrahmanenamah
                          Sri Bhagavadgita
             Atha chaturdasodhyaayah(14th chapter)
             Gunatrayavibhaagayoagaha
                        
Sri Bhagavaan uvaacha:
Param bhooyah pravakshyaami
gnaanaanaam gnaaanamuttamam
yagnaatwaa munayah sarve
param siddhimitogataah             1
Sri Bhagavan said:  
O Arjun, I am telling you again about that pure wisdom which transcends all knowledge. Knowing this the people are freed from this circuit of mundane existence and attained the most attainable salvation.    
Idam gnaanamupaasritya mamasaadharmyamaagataah
Sargepinopajaayante pralayena vyathanticha    2
Embracing this wisdom people become united with Me, get My Form, and neither will they born again at the time beginning of new cycle of Creation, nor will they get destroyed at the time of dissolution. They will not fall in this births and deaths’  cycles.  
Mamayonirmahadbrahma tasmingarbham dadaamyaham
Sambhavah sarvabhootaanaam tatobhavati bhaarat         3
Sri Krishna has not preached Gita as an individual, but as Parabrahman. This is to be observed by the readers. This preaching is called Aatmabodha.
 O Arjun, Mahat Brahma, Moola Prakriti, Maaya(OM), the Great Prakriti, is the Place from which all the beings are manifested by Parabrahman.  Parabrahman keeps the seed of his Consciousness. This causes the Creation
God beyond Creation is vibrationless.
God in Creation, Kootastha Chaitanya, Maaya, Krishna consciousness, is full of vibration. This is called Parasakti.
The vibrating Kootastha Chaitanya is OM, Adisakti. That means the Parasakti keeps the seed of Creation in OM. This Parasakti is the Father. OM is the wife. The Offspring is Hari, the Creation. The Creation is called Hari because it gets destroyed. 
God beyond Creation is the Grand father, God in Creation is the Father, OM is the wife, and Creation is the son.  Son, father, Grand father, everything is God only.
Mohan may be having a car. He has to sit before the wheel and make the car into motion for which he has to vibrate. When he is not vibrating, he is   called Parasakti, potential energy. When he is vibrating to put the car into motion, he is OM, the kinetic energy. The movement of car is his creation.
Sarvayonishu kaunteya moortayassambhavantiyaah
Taasaam brahma mahaadyoni raham beejapradah pita   4
O Arjun, whatever bodies are coming out from men, Devas etc, ––Maaya(primordial Nature) is the Mother, I am the seed providing Father(Kootastha Chaitanya).
Cause and effect is the essence behind Creation.
The potter has made the pot with mud using a machine. .
Here the potter is the Efficient cause( nimitta kaaranam), 
Mud is the material cause(Dravya or Upaadaana kaaranam)
Machine is the Instrumental cause(Sadhanaa kaaranam)
Paramaatma made the Creation with Maya in Him.
Here Paramaatma is efficient, material, and instrumental causes. All is Paramaatma only.
Sattwam rajastama iti gunaah prakruti sambhavaah
Nibadhnanti mahaabaaho dehedehinamavyayam                 5
O mighty armed Arjuna, the three Gunas, Satwa(positive, pure), Rajas(neutral, passion), and Tamas(negative, inertia), that borne out of Prakriti, are binding the Pure Soul, the imperishable, to this perishable body. 
Tatra sattwam nirmalatwaat prakaasakamanaamayam
Sukhasangena badhnaati gnaanasangenachaanagha           6
O, the sinless, of these Gunas, the pure  Satwa gives  enlightenment and it is dangerless. Nevertheless it binds man through attachment to happiness and knowledge.




God has given us this body temple. It is our bounden duty to keep it healthy. For that if we eat, it is not wrong. But if we die with insatiable attachment  to food, then we entangle to Karmas.
Doing good  works is a Soul quality. But if we do them with ‘I ness’, then we will be entangled to Karma. If we dothem without ‘I ness’,and do them with surrender feeling to God, then we will not be bound by Karma. This is called Nishkaamakarma.      
Rajoraagaatmakam viddhi trushnaa sanga samudbhavam
Tannibadhnaati kaunteya karmasangena dehinam   7
O Arjun, the catalyst or activating Rajo guna causes attachment to scenaries, desires due to passion,and interest in the things. It binds the soul due to interest in works.
Tamastwagnaanajam viddhi mohanam sarvadehinaam
Pramaadaalasyanidraabhi stannibadhnaati bhaarata 8
O Arjun, Tamo gun emerges due to ignorance,  deluding all embodies souls. It binds the people strongly by forgetfulness, absentmindedness, sleep, and idleness.  
Satwam sukhe sanjayati rajah karmani bhaarata
Gnaanamaavrutya tut amah pramaade sanjayatyuta 9
O Arjun, Satwa attaches man to happiness with ‘I ness’ feeling, rajas to activity with selfishness, and tamas by eclipsing  the power of discrimination with misconception and danger. 
Rajastamaschaabhi bhooyasattwam bhavati bhaarata
Rajassatwam tamaschaiva tamassatwam rajastathaa   10
O Arjun, when Sattva is predominant, it suppresses Rajas and Tamas; when Rajas is strong, it suppresses Sattwa and Tamas; whenTamas is predominant, it suppresses Sattwa and Rajas.
Sarvadwaareshu dehesmin prakaasa upajaayate
Gnaanam yadaa tadaa vidyaadvivruddham sattwamityuta 11
You know this, when all the sense gates  illuminate with effulgent Gnaana, wisdom,  then Sattwa is prevalent.
Lobhah pravruttiraarambhah karmanaamasamah spruhaa
Rajasyetaanijaayante vivruddhe bharatarshabha     12
O the best among Bharatas, when the greediness, interest in activity, undertaking of undesirable works, restlessness, uncontrollability of senses, and desire arise, then know that Rajas is preponderous.
Aprakaaso pravruttischa pramaado mohaevacha
Tamasyetaanijaayante vivruddhe kurunandana    13 
O the best among Kurus, when ignorance, mental dullness, idleness, carelessness, sloth, obscurity, foolishness, superstition, and preposterousness, arise, then Tamas is in increase.  
Yadaa sattwe pravruddhetu pralayam yaati dehabhrut
Tadottamavidaam lokaanamalaan  pratipadyate      14
When the sadhak dies during the rise of Sattwa guna, then he is getting birth in the houses of people with great wisdom, pure hearted Rishis, Munis, and Yogis.   
Rajasipralayam gatwaa karmasangishujaayate
Tathaa praleenastamasi moodhayonishu jaayate      15
When Rajas prevails at the time of Death, that person takes birth in the houses of people attached to works.
When Tamas prevails at the time of Death,  that person takes birth in the houses of poverty, and in the wombs of animals, birds, and lower echelons.
Karmanassukrutasyaahu ssatwikam nirmalam phalam
Rajasastuphalam dukkhamagnaanam tamasah phalam 16
The result of Sattvic Karma is pure happiness and harmony.
The result of Rajasic Karma is pure pain.
The result of Taamasic Karma is ignorance.
This is what the Great Rishis say. .
Satwaatsanjaayate gnaanam rajaso lobhaevacha
Pramaado mohau tamaso bhavato gnaanamevacha    17
Sattwaguna leads to Gnaana, discrimination,  RajoGuna leads to greediness, and Tamo guna leads to carelessness, forgetfulness, illusion, and ignorance. .        OordhwamGachchantiSattwasthaa
MadhyeTtishtantiRaajasaah
jaghanya gunavruttisthaa
adho gachchanti taamasaah 18
Sattwa predominant people will go to higher echelon worlds after death.
When Sattwa is predominant, the consciousness of the Sadhak during sadhana will be confined to Chakras, Visuddha, Aagnaa, and Sahasraara, in the Darmakshetra of the Merudanda, spinal cord.
Rajas predominant people will go to middle echelon worlds,  i.e., men’s world etc., after death.
When Rajas is predominant, the consciousness of the Sadhak during sadhana will be confined to Chakras, Manipura, Anaahata, and Visuddha, in the Kurukshetra-Darmakshetra of the Merudanda, spinal cord.
Tamas predominant people will go to lower echelon worlds,  i.e., worms, birds, and animals etc., after death.
When Tamas is predominant, the consciousness of the Sadhak during sadhana will be confined to Chakras, Mooladhara, Swaadhishtaana, and Manipura, in the Kurukshetra  of the Merudanda, spinal cord.
Naanyam gunebhyah kartaaram drashtaanupasyati
Gunebhyascha param vetti madbhaavam sodhigachchati 19
When the sadhak conceives that he is different and beyond these three Gunas, then he is getting Me.
Gunaanetaanateetyatreen deheedeha samudbhavaan
Janmamrityu jaraadukkhai rvimukto mrutamasnute  20
The Jeeva, after crossing all these three Gunas which are responsible for the manifestation of this body, is rid of birth, death, oldage, and misery.  Then he attains immortal salvation which is the state of Pure Soul.
Arjuna uvaacha:
Kairlingaistreengunaa netaanateeto bhavati prabho
Kimaachaarah katham chaitaam streengunaa nativarate 21
Arjun said:
O Lord, what signs the sadhak who has transcended all these three gunas will have?  How is his character? How he will overcome these Gunas?
 Arjun wanted to know the characteristics of Jeevanmukta.
The sadhak who cuts off all his attachments with the body when he is alive, then he is called Jeevanmukta.
When the sadhak becomes matured he will address his Guru as Prabhu, the Lord, with reverence. That is why Arjun, the sadhak, is addressing Sri Krishna as Prabhu.
Pertinent to his advancement in his sadhana, the sadhak will get answers to his querries in intuition, Soul wisdom, Aatmabodha.  The answers and counseling from intuition will be coming in different ways. That may come as Sounds, formless good transcendental thoughts, intuitional guidance of feelings, vibrations etc.
The intuitional thoughts may come  as Sakti or force. That sakti becomes more physical and appear as a panoramic sceneray, or as a dream. 
One intuitinal thought may lead to a vibration, then to a sound. That sound will give a perceivable meaning to the sadhak who is burning with fire of concentration with intense meditation. This sound can come in any language whose meaning can be understood by the sadhak very easily.  Some times the consciousnesses of Parabrahman may come as  wonderful fragrances, or as readable words in the sky. These are called Radio or TV signals. In Sanskrit they are called Aakaasavaani words.          
Sri Bhagavaan uvaacha:
Prakaasamcha pravruttimcha mohamevacha paandava
Nadweshti sampravruttaani nanivruttaani kaankshati 22 
Udaaseena vadaaseeno gunairyona vichaalyate
Gunaavartantaityeva yova tishtati nengate            23
Samadukkha sukhahswasthassamaloshtaasmakaanchanah
Tulyapi yaapriyo dheerastulya nindaatma samstutih 24
Maanaavamaanayo dheerastulyastulyo mitraaripakshayoh
Sarvaarambhaparityaagee gunaateetassa uchyate      25
Sri Bhagavaan said:
O Arjun, he who neither abhor the presence of these three Gunas, sattwa(illumination),  Rajas(activity),  or Tamas (ignorance, or slothetc), nor deplore their absence;  remains neutral and undisturbed by Gunas, and their works, ––realizing that these are the handiwork of Gunas, who is undisturbed in all circumstances, who is even minded in pleasant and unpleasant situations, anchored to Soul,  who maintains equanimity towards mud, stone,or gold––( the figures that appear on the screen, male, female, or any thing are the same light rays that come out of a projector), equal mindedness towards likes and dislikes, disowning the responsibility of ‘I ness’ on the works and surrendering everything to God, courageous, he who abandons personal doership of all actions, and remain anchored to God incessantly, is said to be transcender of Gunas.   
Maamcha yovyabhichaarena bhaktiyogena sevate
Sagunaan samateetyaitaan brahmabhooyaayakalpate 26
The sadhak who serves Me with undeviating devotion, he is undoubtedly fully overcoming all these Gunas, becoming Jeevanmukta and able to become Brahman.
Brahmanohi pratishtaaha mamrutasyaavyayasyacha
Saaswatasyacha dharmasya sukhasyaikaantikasyacha 27
Because Iam the imperishable, Formless, the indestructible,  eternal embodiment of righteousness, and unalloyed Bliss.
Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                    Gunatrayavibhaagayogonaama chaturdasodhyaayah(14th chapter)
                               Aum, Tat, Sat.

             Om SriKrishna ParaBrahmanenamah
                          Sri Bhagavadgita
             Atha panchadasodhyaayah(15th chapter)
              Purushottamapraaptiyogah
Sri Bhagavan uvaacha:
Oordhwamoolamadhah saakhamaswattham praahuravyayam
Chandaamsi yasya parnaani yastam vedasa vedavit   1
Sri Bhagavaan said:
O Arjun, The Aswattha tree,has its roots above and branches beneath. The learned states this tree of life as Aswattha tree as eternal one with vedic hymns as its leaves. This tree will not die till the attainment of Gnaana, pure wisdom. He who understands this is a veda knower.   
The hair in the head of the man is akin to Aswaddha tree whose roots are up. The Cosmic consciousness  enters Sahasrara underneath the Brahmarandhra through Medulaa.
That consciousness is absorbed by the hair roots in the head. This Cosmic consciousness from Sahasraara flows through the other six chakras, junction boxes. They are Agna, Visuddha, Anaahata, Manipura, Swadhistaana, and Moolaadhaara.  From there the consciousness will enter into nerve centres, nerves, lungs, Heart, and Kidneys etc. That is the reason  man is compared to Aswaddha tree.
Adhaschordhwam prasrutaastasyasaakhaa
Gunapravruddhaa vishayah pravaalaah
Adhaschamoolaanyanusantataani
Karmaanubandheenimanushyaloke      2
This life tree is spread from above(Brahmaloka) and to below(Bhooloka), nurtured by Gunas, its buds are the objects of senses. In the world of man kind, it will entangle this life tree to karma, so that its roots are firmly and strongly spread. 
Naroopamasyeha tathopalabhyate
Naantonachaadirnachasampratishtaa
Aswatthamenam suviroodhamoola
Masangasasrena drudhenachitwaa        3
Tatah padam tatparimaargitavyam
Yasmingataananivartantibhooyah
 Tamevachaadyam purusham prapadye
Yatah pravrutti prasrutaapuraani       4 
The real nature of this life tree cannot be understood this way by the people interested in mundane things.  Such ordinary worldly people cannot understand its beginning, middle, and end. This strong rooted Aswaddha life tree has to be uprooted with equally strong weapon called unattachment.
Then they should take the shelter of Parabrahman from whom this eternal life tree has been manifested. He must do kriyayoga sadhana and enter into Him so that the sadhak will not again entangle in this mundane existence.
Nirmaanamohaa jitasangadoshaah
Adhyaatmanityaa vinivruttakaamaah
Dwandvairvimuktaah sukhadukkhasanghaih
Ganchchntyamoodhaah padamavyayam tat  5
Those sadhaks who are free from Affection, ego, ignorance, attachment, interest in visible things, and who are always having Soul wisdom, who are anchored to Brahman, who are completely rid of desires, devoid of dualities like pleasure and displeasure—such men of wisdom are attaining that state of eternal Parabrahman.   
Natadbhaasayatesooryo nasasaanko na paavakah
Yadgatwaana nivartante taddhaama paramam mama  6
That Place of self effulgent Parabrahman cannot be illumined by Sun, Moon, and Fire. Having reached Me, the supreme place, no one will again return to this mundane existence.   
Mamaivaamso jeevaloke jeevabhootassanaatanah
Manah shastaaneendriyaani prakrutisthaani karshati  7
The Soul is an integral part of eternal Spirit. This manifesting as a  Soul, in the world of beings, becoming impure and called Jeeva.  This attracts to itself the five senses and sixth one Mind.
 Sareeram yadavaapnoti yachchaapyutkraamateeswarah
GruheetwaitaaniSamyaatiVaargandhaanivaasayaat          8 Jeeva is the Lord of the body kingdom. When air passes through the flower gardens etc it carries the fragrance of the flowers along with it. Likewise when jeeva leaves this body, He will carry the five senses and mind along with Him.  When transmigrates to another body He will bring these six things alongwith Him.
Srotram chakshusparsanamcha rasanam ghraanamevacha
 Adhishtaayamanaschaayam vishayaanupasevate  9
This Jeevaatma experience the things such as hearing, sight, touch, taste, and smell,  with the aid of five senses and mind.
 Uddhaamantam sthitamvaapi bhunjaanamvaa gunaanvitam
Vimoodhaanaanupasyanti  pasyanti gnaanachakshushah 10 
When Jeeva transmigrates from one body to another body, when He exists in the body, experiencing the sense pleasures with Gunas, the ignorant cannot understand this. Only those whose third eye(Gnaananetra) is opened can understand their own self.
Kriyayoga:
40,000 proteens are required for daily routine work.  Kriya yoga aids in increasing these proteens by which disease, and oldage will be kept at bay. 
The coordination between different organs like lever, lungs,Heart etc and life cells decreases gradually with age. This leads to diseases. Only through Kriyayoga practice this coordination is possible.
Hydrogen Bomb is made on the principle of Fusion(baahya kumbhak).  The diseased cells can be made healthy through fusion.  In fusion the life cells can be left without and energy is  created.   
Atom Bomb is made on the principle of Fission (Antah kumbhak).  The diseased cells can be made healthy through Fission.  In Fission the life cells can be concentrated within in Kootastha(Aagnachakra) and energy is  created.   
Ida subtle nadi is Ganga, Pingala subtle nadi is Zamuna, and Sushumna subtle nadi is Saraswati. The confluence pf these three subtle nadis in Kootastha is Triveni sangamam.
The awakened is made to reach Sahasraara through Sushumna is called Samadhi.
Kriyayoga is a physical and mental process. 
In this yoga the carbon in the blood is removed. It will invigorate with oxygen. 
 The life cells in the cerebrum will become positive North pole, and the cells in the rest of the body will become negative South pole.
Sadhak will inhale life force fully upto Aagna Positive Chakra in Kootastha, then exhale it fully upto Moolaadhaara and by this he produces Electro magnetic force. This decreases the decay of life cells. Heart and cranial nerves will get rest and energy.
There are six chakras in the spinal cord.  They are: Moolaadhaara, Swadhishtaana, Manipura, Anaahata, Visuddha, and Agna in Kootastha. The 12 Rashis exist at the rate of 2 rashis per chakra.  The Rashis exist on either side of each chakra. Kriyayogi will pull his life force from Moolaadhaara up upto Kootastha(Aagna positive) and from Kootastha down upto Moolaadhaara chakra. One kriya burns one year of Karma.  This way he does one Kriya. Doing Kriyas this way, the Kriyayogi beholds the AatmaSurya(Soul sun) rotating the life force in these 12 Rashis.
Sun travels at the rate of one month per one Rashi. Sun takes one year to make one rotation around 12 Rashis.  Elapsing of one year is equal to experiencing one year of Prarabdha Karma. 
To burn our Sanchita Karma, past karma, 10lakhs years’ of healthy life is required.  The kriyayogi can burn this Karma by doing 1000kriyas per day for three years.  this way he can get the development of 10lakhs years in one life span itself.
 In a systematic way of doing Kriyas regularly, one can burn the Karma of 10lakhs’ years and gets development in  6, 12, 18, 24, 30, 36, 42,and 48 years. In case of not getting consummate development in one birth, the Kriyayogi will carry the results of his Kriyayoga alongwith him to the next birth.
The life of a Kriyayogi is not influenced by his past karmas. He will be guided by his soul intuition. 
Kriyayoga is to be done in complete solitude and with limited food.
Kriyayoga consists of Hathayoga, energisation exercises, layayoga, SoHam and OM techniques, Karmayoga(service), Mantrayoga including chanting Beejakshar(Root word) chanting in Chakras, Raajayoga consisting of techniques of Praanaayaama.
The kootastha(Aagna +) is North pole. Moolaadhaarachakra is South Pole. The kriyayogi makes the spinal cord into a electro magnet by rotating the life force from South pole to North pole,  and from North pole to South pole.  By doing so, the currents from Moolaadhaara to Visuddha chakra are brought to Sahasrara underneath the Brahmarandhra through the Sushumna of Spinal Cord.  This gives the Kriyayogi immeasurable pleasure.  If the Kriyayoga is done with some appropriate Hand Mudras, then the Merudanda, spinal cord, will be further energized. 
Life force is having both intelligence and energy. Oxygen is having energy only.
The Sareera(body) can become ossified,  the Deham(Body) can be subjected to burning, and the Kalebaram(Body) can become rotten.  The Kriyayogi will overcome all these predicaments of the body.             
Yatantoyoginaschainam pasyantyaatmanyavasthitam
Yatantopyakrutaatmaano nainam pasyantyachetasah 11                
Those Yoga sadhaks who are making efforts to know about themselves are understanding this Soul. Some of those efforters are unable to understand and see the Self because of impure Antahkarana. 
That is why one must do Kriyayoga sadhana.
Yadaadityagatam tejo jagadbhaasayatekhilam
Yachchandramasiyachchaagnau tattejo viddhimaamakam 12
The light in Sun that illumines the whole world, the light in the Moon, and the light in fire—all this radiance is of  Parabrahman only, know this.  
Gaamaavisyachabhootaani
 dhaarayaamyahamojasaa
Pushnaamichaushadheessarvaa
ssomobhootwaa rasaatmakah 13
And Iam permeating earth with my effulgence and Iam sustaining all the living creatures. I as the watery Moon am giving strength to all plants. 
The subtle Ego, sookshma sareera ahamkaar, is the middle man of Physical body, Sthoolasareera, body bound attachment, and Soul wisdom, Aatmatatwa.
Aham vaiswaanarobhootwo
praaninaam dehamaasritah
Praanaapaana samaayuktwaa
 pachaamyannam chaturvidham 14
As a Vaiswaanara fire in the stomach, exist in the beings, and digesting four types of the food with Prana and Apaana vayus which again My Forms only.
Sarvasyachaaham hrudi sannivishto
Mattah smrutirgnaanamapohanamcha
Vedaischa sarvairahamevavedyo
Vedaantakrudvedavidevachaaham              15
Iam seated in the heart of all beings. Memory, and forgetfulness are happening to the Jeeva due to My existence in fact. I only am the knower through Vedas. Iam the author of Vedaanta. The subject of Vedas are also Me only.
Veda means to hear OM sound.   Vidhi means Dharma, duty. Hearing OM sound is Veda Vidhi, one’s bounden duty. 
 OM:
Om is sound and its replica also. Om is the combination of three sounds viz., Akaara, Ukaara, and Makaara.  It is having the quality of Universalism. 
Whole Cosmos is emerged out of Sphotam, Sound, only. This is called Manifested Brahma, Vyaktabrahma.  It encompasses all the sounds in It.
Akaar represents Srishti(Creation) Brahma which is in Bindu form,
Ukaara represents Sthiti (Existence) Vishnu,
Makaar represents Laya(destructer) Maheswar.
Soul is subtler than Atom, and greater than Cosmos. The meditator hears the sound of OM in his Kriyayoga sadhana. This called Nadabrahma. This will make the sadhak unite with Parabrahma.  The goal of all Vedas is OM only.
Viswa, Tejasa, Pragna, Pratyagaatma, Viraat, Hiranyagarbha, Avyaakruta, and Paramaatma are eight limbs of OM,
Akaara, Ukaara, Makaara, and Arthamatra(Half point) are four feet of OM,
Jaagrata(Waking state), Swapna(sleeping), and Sushupti
(super conscious) are three states of OM, and
Brahma, Vishnu, Rudra, Sadaasiva, and Maheswara are the five deities of OM.
The one who does not know OM or hear that sound cannot attain Brahman.
Hrasvodahati paapaani deergho mokshapradaayikah
Adhyaayanah plutovaapi trividhochchaaranena tuh
Om chanting can be:
Hraswam = shorter,  Plutam = little longer,  and Deerham = very long.
Hraswa Om chanting will remove sins, Plutam Om chanting  will provide Ishtasiddhi or fulfiller of righteous desires, and Deergham Om chanting is salvation giver, Muktipradaayini.
If OM is chanted loudly audible(sthoolam), then it is called Naadam or Vaachakam.
If OM is chanted loudly audible(sookshmam) in the Visuddhachakra without opening the mouth, then it is called Upaansu or Bindu.
If OM is chanted mentally(Kaaranam), then it is called Kala or Maanasikam.
Uttamah tatwachintanam madhyamaasaastrachintanam.
Athamaa mantrachintanam teerthabhraanti athamaathamaa
Chintanam means to think and memorise.
Brahmachintanam is considered to be First category.
Sastra(Scriptures) chintanam is considered to be Second category .
Mantrachintanam is considered to be third category.
And Teertha chintanam (pilgrimage) is considered to be Fourth and lowest category.
           
Dwaamivau purushau loke ksharaaschakshara evacha
Ksharaassarvaani bhootaani kotasthokshara uchyate 16
There are two Purushaas are there in this Cosmos, Kshara and Akshara.  All beings are Ksharas, destructible, and Akshara, the indestructible Kootastha Purusha.  
Uttamah purushastwanyah paramaatmetyudaahrutah
Yolokatramaavisya bhibhartya vyaya eeswarah       17
There exists Another Highest Being designated as Supreme Spirit, uttama Purusha. He is different from Kshara and Akshara. He permeates the three worlds.
Yasmaatksharamateetoha maksharaadapichottamah
Atosmilokevedecha prathitah purushottama    18
Iam beyond the indestructible Kshara(Prakriti), am Greater than indestructible Akshara(Jeeva) and hence being famously called as Purushottama in Vedas and Cosmos.
Yomaamevamasammoodho jaanaati purushottamam
Punarvidbhajati sarvabhaavena bhaarata    19
O Arjun, whosoever, freed from delusion, knows Me as Purshottama, the Supreme Spirit, then that sadhak will worship Me always as Parameswara with fully contented Mind.                   
Itiguhyatamam saastramidammuktam mayaanagha
Etadbuddhvaa buddhimaan syaatkrutakrutyascha bhaarata 20
O the sinless Arjun, this way I had said the most secretive Sastra, the most profound wisdom, to you. The sadhak who grasps this knowledge will be a successful man of pure wisdom.  
Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                    Purushottamapraapti yogonaama panchadasodhyaayah(15th chapter)                               Aum, Tat, Sat.

           Om SriKrishna ParaBrahmanenamah
                          Sri Bhagavadgita
             Atha shodasodhyaayah(16th chapter)
             Daivaasurasampadwibhaagayogah
Sri Bhagavaan uvaacha:
Abhayam sattwasamsuddhir
 gnaanayogavyavasthtah
DaanamDamaschaYagnascha
Swaadhyaayam Tapa aarjavam              1
Ahimsaa satyamakrodhaastyaagaassaantirapaisunam
Dayaa bhooteshvalolastwam maardavam hreerachaapalam 2
Tejah kshamaa dhrutissaucha madroho naatimaanitaa
Bhavanti sampadam daivee mabhijaatasya bhaarata       3
Sri Bhagavaan said:
O Arjun, fearlessness, purity of Antahkarana(heart), be in Gnaanayoga, charity, control of senses within and without, performing Gnaanayagna, study of scriptures, penance, not having covetousness, not to cause pain to any creature(to murder animals in the name of sacrifice is atrocity), non violence, compassion to all creatures,  to take shelter in Paramaatma, truthfulness, not having anger, sacrifice, not to carry tails, not having undue interest in acquiring things, tenderness, feeling shame to do unrighteous things, lack of restlessness, radiance of character, patience, endurement, courage, having clean heart within and without, not to harm anybody, not having egoistic ‘Iness’, not having the quality of ‘one upmanship’—are the qualities of virtue inherent in the people born with godly nature.     
When sadhana is advancing, these godly qualities will be adhered to the sadhak. So one should do Kriyayoga sadhana trusting the will power given to him by Parabrahman.than cursing the past karma.               
English modern medicine, Ayurveda, the age old medicine, Prakriti Vaidya medicine, or Homeo medicines, all are the creations of Parabrahman only.
So it is not compatible to say that one particular branch of medicine is superior to all others.
English medicine pertains to physical body.  It pertains to first three chakras, Moolaadhara, Swadhishtaana, and Manipura. 
Homeo medicine pertains to physical and subtle bodies.  It pertains to Moolaadhara, Swadhishtaana,  Manipura, and Anaahata chakraas.. 
In Ayurveda  medicine Pitta(Heat), vaayu(Air), and Kapha(moisture) should be in proper proportions failing which disease takes place.  This pertains to  pertains to Moolaadhara, Swadhishtaana,  Manipura, Anaahata, and Visuddha chakraas.. 
 In Prakriti Vaidya(Naturopathy), body house cleaning is important ingredient. For this they make the person to drink lemon juice, and Ginger juice. Mud will be applied to the body and after some time the person will be bathed.  Like this several other things will be there in Naturopathy. This pertains to  pertains to Moolaadhara, Swadhishtaana,  Manipura, Anaahata, Visuddha, and  Aagna chakraas..
Yoga postures and controlling Praanaa through the procedures  of Ashtaanga yoga of Pataanjali pertain to Moolaadhara, Swadhishtaana,  Manipura, Anaahata, Visuddha,  Aagna chakraas, and hence pertaining to  Sahasraara chakras. Physical, subtle, and Idea bdies. Therefore real Medicine or Holistic approach is Meditation only.   
Dambhodarpabhi maanascha krodhah paurushyameva cha
Agnaanamchaabhijaatasya paardha sampadamaasureem 4
O Arjun, vainglorious pride, arrogance, conceit, wrath, anger,  harshness, and ignorance, are the qualities of vice  in the people born with demonly nature. 
Daiveesampadvimokshaaya nibandhaayaasureemataa
Maasuchah sampadam daivee mabhijaatosi paandava 5
O Arjun, the divine qualities will free the man from the circuit of mundane existence. The demonic qualities entangle the man in the circuit of mundane existence. You are born with godly qualities and hence you need not be afraid.
One should do Kriya yoga sadhana and get rid of himself from this mundane existence.
 Dwau bhootasargau lokesmin Daiva aasura evacha
Daivo vistarasah prokta aasuram Paardha me srunu     6
O Arjun, in this world two types of living beings exist, godly and demonic. I had expatiated about men of godly qualities. Now listen in detail about the men born with demonic attributes.
Pravruttimcha vruttimcha janaanaa viduraasuraah
Nasaucham naapichaachaaro nasatyam teshu vidyate 7
The demonic people donot want to know the path of right action nor  wanted to come out of  wrong path. They lack purity, truth, and proper conduct.  
Asatyamapratishtamte jagadaahuraneeswaram
Aparasparasambhootam kimanyatkaama haitukam     8
They say: This world has no basis, untruth, God does not exist at all, the mutual lustful desire of man and woman is the cause of this creation and there is no other reason behind it.  
Etaamdrushtimavashtabhya nashtaatmaanolpa buddhayah
Prabhavantyugrakarmaanah kshayaayajagatohitaah     9
With this attitude of Atheism, mind spoiled, with shallow intellect, interested in doing cruel deeds, are not thinking about Soul, and becoming enemies to the world and working for its destruction. 
Kaamamaasritya dushpooram
dambhamaanamadaanvitaah
Mohaadgruheetwaa sadgraahaan
pravarntante suchivrataah 10
They are imbued with satiable lust and vainglorious pride. They without any discrimination and ignorance, obstinately follow impure duties, and are behaving with mean professions.
Chintaamaparimeyaamcha pralayaantamupaasritaah
Kaamopabhogaparamaa etaavaditi nischitaah            11
They submerge in unending thoughts till death. Fully indulged in sense pleasures thinking that they are the real happiness.  
Aasaapaasa satairbaddhaah kaamakrodhaparaayanaah
EehanteKaamabhogaardhaManyaayeNaardhaSamchayaan 12
They are bound by physical desires always. They behave with passion and wrath.  For sense pleasures they strive to amass wealth through foul means.   
Idamadymayaalabdha mimam praapsye manoratham
Idamasteedamapi me bhavishyati punardhanam        13
Asaumayaa hatassatrurhanishye chaaparaanapi
Eeswarohamaham bhogee siddhoham balavaan sukhee 14
Aadhyobhijanavaanasmi konyosti sadrusomayaa
Yakshyedaasyaami modishya ityagnaana vimohitaah  15
Anekachitta vibraantaa mohajaalasamaavrutaah
Prasaktaah kaamabhogeshu patanti narake suchau    16
This desire I have acquired today, this another desire I can get fulfilled further.  This property I got now, I can get more.
I had killed this enemy now, I can annihilate other enmies also.  I am the Lord, enjoyer of all pleasures. I can get the contemplated works fulfilled. Iam strong, happy, wealthy, and born in a noble dynasty. Iam unparall. I do yagnas, give charities, enjoy happiness. This way they speak with attachment, delusion, and unsteady mind,  due to ignorance.
 They are aattached to and covered fully with the net of spouse, offspring, and fields.  They are very much interested in desires. With this demonic attributes they are falling in impure Hell.         
Aatmasambhaavitaah stabdhaa dhanamaana madaanvitaah
Yajante naamayagnaiste dambhenaavidhipoorvakam 17
Ahamkaaram balam darpam
kaamam krodham cha samsritaah
maamaatma paradeheshu
pradvishantobhyasooyakaah                  18
Deeming themselves to be great, not having humbleness and eticacy, lasciviousness, and self-esteem due to wealth, egoistical,  causing difficulties to others, proudy, lustful, impregnated with anger, despise Me who dwells within them and all others, and jealous, —are the people born with demonic qualities. They do yagnas with pride for name sake without scriptural sanctions.   
Taanaham dwishatah krooraan samsaareshu naraadhamaan
Kshipraamyajasrama subhaanaasureeshveva yonishu 19
But Iam throwing evil, cruel, who hate Me present in all beings, and sinful such people into the meanest births again and again.      
Aasureem yonimaapannaa modhaajanmanijanmani
Maamapraapyaiva kaunteya tato yaantyathamaamgatim 20
O Arjun, those people who are born in mean wombs, are again and again falling in wombs meaner than the earlier ones without getting Me.
Trividham narakasyedam dwaaram naasanamaatmanah
Kaamah krodhastathaalobha stasmaadetatrayam tyajet  21 
O Arjun, Lust, anger, and greed are three hell gates. These cause destruction to man. So man should abandon these three.    
Etairvimuktah kaunteys tamodwaaraistribhirnarah
Aacharaatmanah sreyastato yaati paraam gatim      22
O, son of Kunti, the man is doing himself a great help by completely turning away from this threefold gate. Then he will attain the highest goal of salvation.
When the sadhak goes within, he hears the sound of OM. When the sadhak merges with that auspicious Sound OM, then he hears so many truths are heard in different languages.
These are the truths heard by the Great ancient Rishis. These saastraas are called SRUTIS. These Srutis appear in illuminating golden letters. I had experienced this many a number of times. These are called AAKAASAVANI letters or sounds.
Yogi in his intense sadhana can see the subtle nadis, Ida, Pingala, and Sushumna.
Yogi can experience in his Merudanda, spinal cord, the following:
The vibrations of Panchabhootas responsible for the creation of the world can be felt by hin in the chakras. He will experience them in different effulgences.
Prithvi tatwa vibrations in Moolaadhaarachakra,
Varuna tatwa vibrations in Swadhishtaanachakra,
Agni tatwa vibrations in Manipurachakra,
Vaayu tatwa vibrations in Anaahatachakra,
Aakaasa tatwa vibrations in Visuddhachakra, and in
Aagnachakra in the Kootastha the sutle third eye, the Gnaana netra.  
Yassaastra vidhimutsrujya vartate kaamakaaratah
Nasasiddhimavaapnoti nasukham naparaamgatim  23
He who abandons scriptural instructions and follows his own whims cannot find happiness, perfection, or the greatest goal of salvation.
Patanjali Ashtaangayoga:
1) Yama: Ahimsa(non-violence), Satyam(truthfulness), Aasteyam(not to steal anything), Aparigrahanam(not to expect anything from others) 
2)Niyama: Saucham( purity of body and mind), Santosham (contentment),Swaadhyaayam(scriptural reading),  and Eeswara pradhaanam(surrendering to God).
3)Aasana: Steadyness with sitting posture.
4)Praanaayaama: controlling breath.
5)Pratyaahaara: Withdrawal of senses.
6)Dhaarana: Concentration on the object.
7)Dhyaana: Concentration only on God.
8)Samaadhi: Sama = equal, Adhi = with God, merger with God.
Dhaarana, Dhyaana, and Samaadhi together are called Samyak Samaadhi.
Dhyaan should start with seed initially and in the end it should become seedless.     
Tasmaachchaastram pramaanam te
kaaryaa kaaryavyavasthitau
gnaatwaa saastravidhaanoktam
karmakartumihaarhasi                        24
When you are in doubt as to what is to be followed or not to be followed, then scriptures give guidance.  Doing Karma in this world by following the scriptural instructions is desirable to you.
Om chanting, in chakras, and Beejaakshara(Root word) chanting  in chakras are the part of Kriyayoga. The sadhak will drive out the darkness in chakras with these techniques.  Then only he will be able to  completely root out threefold hell gate, lust, anger, and greediness.     

Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                    Daivaasurasampadwibhaagayogonaama shodasodhyaayah (16th chapter)                           
   Aum, Tat, Sat.


               Om SriKrishna ParaBrahmanenamah
                          Sri Bhagavadgita
             Atha saptadasodhyaayah(17th chapter)
             Sraddhaatrayavibhaaga yogah
Arjun uvaacha:
Yesaastravidhimutsrujya
yajante sraddhayaanvitaah
Teshaamnishtaatu kaa Krishna
Sattwamaahorajastamah                1
Arjun said:
O Krishna, those who give up the scriptural instructions and do the Poojas(worship) with devotion—what is their status, Saatwika, Raajasa, or taamasa? What is their nature?
Sri Bhagavaan uvaacha:
Trividhaa bhavati sraddhaa dehinaam saa swabhaavajaa
Saattwikee raajaseechaiva taamasee cheti taam srunu   2
Sri Bhagavaan said:
O Arjun, the nature of the people is three fold which comes as per their past (lives) habits. They are: Saatwika, Raajasa, or taamasa. Listen indetail.
Sattwaanuroopaasarvasyasraddhaabhavati bhaarata
Sraddhaamayoyam purushoyoyachchraddhassaevasah 3
O Arjun, the devotion, dedication, qualities, and habits of people is aligned as per their past habits that are engraved in their Antahkarana. 
Yajantesaatwikaadevaan yaksharakshaami raajasaah
Pretaan bhootaganaam schaanye yajante taamasaajanaah 4
The saattwik people worship Devas, Rajoguna people worship Yakshas and Raakshasaas, and Taamasa guna people worship Bhootaas and Oretas.
Asaastravihitam ghoram tapyamte yetapojanaah
Dambhaahamkaara samyuktaah kaamaraagabalaanvitaah 5
Karsayantassareerastham
bhootagraamamachetasah
Maamchaivaantassareerastham
taanviddhyaa suranischayaan        6
Animal like strengthy people, with arrogance, ego, desires lust, attachment, and longing, adopt  terrible austere measures without any scriptural sanctions and do very difficult penances whimsically. They not only torture the senses but also by implication offend Me, the Indweller. They are ignorant and are of Asura nature.   
Soul is pure. Man will be accompanied by the experiences that hs happened in this life till he get self realization. Those Yogis only who have attained the ability for salvation while in body, will have contact with God.  Such yogis only can give direction and guidance to other seekers. 
In subtle world also there will be existing animal like beings, vice people, ordinary beings, good beings, Yogis, and Mahayogis, living intheir peripheries. 
The unlocked, unattended, and unguarded Motor vehicle will be stolen by thieves and make thrm as their own. Likewise so many tramp souls in subtle world will be waiting to fulfil their desires for which a body container is required.
Man should not keep his empty. He should make his mind busy with one work or another lest the tramp souls from the subtle world will enter into these blank minded people.  Especially they can easily make the weak, diseased, and blank minded people, as their abode to fulfil their desires. Therefore it is not advisable to keep our mind to others for experiments or for anything.
In super conscious state we meet Mahayogis, Rishis, and Great Souls during our meditation. We can easily recognize them with the aura around them.  
Aahaarastwapi sarvasya trividhobhavati priyah
Yagnastapastathaa daanam teshaam bhedamimam srunu 7
The food also is of three types as per the nature of people. 
Likewise their yagnas, penances, and charities, are also of three types. Listen in detail:
Therefore we should think carefully before taking our food. Our behavioural pattern is proportional to the type of food we take.  That is why saattwik food is highly desirable.
With pure saattwilk food mind will be purified. The pure mind will lead attainment of Parabrahman.  
Aayussatwa balaarogya
sukhapreetivivardhanaah
Rasyaah snigdhaah sthiraa hrudyaa
aahaaraah saattwikapriyaah               8
Foods that increase the longevity, body strength, health, happiness, propitiation; liquids or  savouries like milk, jaggery,  fruit juices; oily foods like edible oils, butter, and ghee etc.,; the foods that increases Ojas; substantial foods; mild foods that increase saatwik qualities,  are liked by Saatwikas, the pure or near pure minded people.
Katwwamlalavanaatyushna teekshna rooksha vidaahinah
Aahaaraa raajasa syeshtaa dukkhasokaamayapradaah 9
Foods that are bitter, Pungent, more hot, that causes thirst, unhappiness, and that disturb mind, are dearer to Raajasic people.  
Yaatayaamamgaatarasam pootiparyushitam cha yat
Uchchishtamapichaamedhyam bhojanam taamasapriyam  10
Foods that are not boiled properly, essenceless, the foods that give bad smell, the food that was cooked one night before, insipid, rotten, and leftover food, the foods that are not given to God before eating, and impure, are dearer to Taamasic people.
The food taken by the man will be transformed into three changes by the Fire in the stomach, Jatharaagni.
1) Sthoola (Solid)portion will be transformed into stool and urine,
2) The middle liquid portions will be turned into fluid, blood, and seven dhaatus, and
3) the last and final air part will be formed into mind.
Compare the above with Pancheekaran.
Aakasa: Parabrahman;   Vaayu or Air: Mind;  Agni: Buddhi or intellect; Jalam or water: Chittam or feelings; Prithvee or Earth: Ahamkaar or ego. 
So mind is the culmination of food.
1) the one who encourages violence of killing animals, eggs, and lambs etc., which are having shukla(sperm) and Sonita(ovum) for food, (2) the one who preaches meat eating is superior, (3) the butcher, (4) seller, (5) the buyer of meat, (6) cook, (7) supplier, and (8) eater, are all called Ghaatukaas.
Man is having 33 vertebre in his spinal cord. He possesses 32feet of intestines, and 32 teeth in his mouth.
It will take 24 hours for the man to digest his vegetarian food. At least he must grind the food 8 times with his teeth before swallowing his food.
Animal possesses  11 vertebre, 10 feet of intestines, and 10 teeth.  That means the animal contains everything 1/3 rd of what man contains. That is why it musticates the food through out the day for digestion.
If man takes this animal meat, it will take 72 hours to digest it. While butchering the animal, it will have fear, leaves dung with fear and anger. It feels that the butcher also should have same fate. Even the teeth of man are also not suitable to eat meat. So one should give up meat eating immediately.
If the branches of a tree is cut then again the same types of leaves and fruits will come, the leaves and fruits of other tree will not come.  
In Vedas the Parabrahman is spoken of as very very kindhearted. Ahimsa paramo dharmah i.e., Non violence is the greatest Dharma is the essence of scriptures. Parabrahman has taken different incarnations to protect the people of virtue from the demons.  How such Paramaatmaa can encourage meat eating.  It is not the dumb driven animals that are  to be butchered in Yagnas, but the Arishadvargaas viz., Kaama(desires), krodha(anger),  lobha(greediness), moha(delusion), mada(pride), and maatsarya (jealousy). 
12 qualified uttam praanaayaamas = Pratyaaharam, devoid of sense pleasures.
144 uttam praanaayaamas =  Dhaarana, concentration,
20,736 uttam praanaayaamas = samaadhi, ecstatic union with God.
So for ecstatic union with God, it is highly deplorable to butcher dumb animals.                    
Aphalaakaamkshi bhiryagno vidhidrushtoya ijyate
 Yashtavyame veti manassamaadaaya sa saattwikah 11
This Yagna is desirable to me, Iam mentally agreed to do this Yagna, this is having scriptural sanction, and is done without any desire for  fruits of action—if it is done this way then that person is doing saatwik yagna.               
Abhinandaayatu phalam dambhaardhamapi chaivayat
Ijyate Bharatasreshtatam yagnam viddhi raajasam   12
O the best among Bharatas, if yagna is done with the desire of getting fruits,  and for reputation, then that is Raajasic yagna. 
Vidhiheenamasrushtaannam mantraheenamadakshinam
Sraddhaavirahitam yagnam taamasam parichakshate 13
That yagna which is performed not in accordance with scriptures, lack of Mantras or chantings, lack of charities, and without any dedication, then it is Taamasic yagna.
Devadwijaguru praagnapoojanam sauchamaarjavam
Brahmacharyamahimsaacha saareeram tapauchyate   14
Veneration of Devas, sadhaks who are doing Brahma sadhana, Sadgurus, the Great Souls; purity within and without, not having hypocrisy in word and mind, straightforwardness, celibacy or continence, nonviolence, are considered to be penance or austerity of the body, Saareeraka Tapas.
In fact to walk in Brahma is Brahmacharya.
The one who knows himself is Swami.
Anudwegakaram vaakyam satyam priyahitamcha yat
 Swaadhyaabhyasanamchaiva vaamgmayam tapa uchyate 15
The one that does not create any agitation to the mind, truthful, dearer, beneficial, consists of scriptural reading, consists of chanting of OM sounds and names of Parabrahman, is called Vaachika Tapas.
Manah prasaadassaumyatwam maunamaatmavinigrahah
Bhaavasamsuddhirityetattapomaanasamuchyate       16
A calm and undisturbed mindset, peaceful nature, always remembering God, self control, purity of mind, is said to be Maanasika Tapas.
Sraddhayaaparayaataptam tapastrividham naraih
Aphalaakaamkshibhiryuktaih saattwikam parichakshate 17
People who do Karma without expecting results are doing saareeraka tapas, people who always remember God are doing Vaachika tapas, and people who are steady minded without any disturbance in the least are doing Maanasika tapas,—these three types of people of dedication  are said to be in the category of Saattwika tapas.    
Satkaaramaanapoojaartham tapodambhenachaivayat
Kriyate tadihaproktam raajasam chalamadhruvam     18
Austeries which give the unstable, and undtermined results, are said to be Rajasic if the Poojas, worships,  or penances are performed so as to be honoured, and respected by the people.
Moodhagraahenaatmano yatpeedayaa kriyate tapah
 Parasyotsaadanaartham tattaamasa mudaahrutam    19
The worships that are performed with obstinate ignorance or foolishness by torturing themselves or performed to do harm to others with incompatable starvations without taking food etc is said to be Taamasic.  
Daatavyamiti yaddaanam deeyatenupakaarine
Desekaalecha paatrecha taddaanam saatwikam smrutam 20
To give charity with the feeling of ‘charity is my righteous duty’ at auspicious places, and times, to the able persons without seeking any returns with selflessness is said to be Saattwika daanam.
Yattupratypakaaraartham phalamuddisya vaapunah
Deeyatecha pariklishtam taddaanam raajasam smrutam 21
The charities that are given with the intention of gaining merit, return,  mental distress or pain, is said to be Raajasic  daanam.
Adesakaale yaddaanamapaatrebhyascha deeyate
Asatkrutamavagnaatam tattaamasamudaahrutam      22
The charity that is given without any respect, good intention, contemptuously, to a wrong person at wrong time and wrong place, is said to be Taamasica daanam.
Om tatsaditi nirdeso brahmanah strividhah smrutah
Braahmanaastena vedaascha yagnaascha vihitaah puraa 23
Brahman is having three names, OM, TAT, and SAT. The Brahmagnaanis(knowers of Brahman), Vedas, and Yagnas came out from such Parabrahma with three Names.
Tasmaadomityudaahrutya yagnadaanatapah kriyaah
Pravartante vidhaanoktaa ssatatam brahmavaadinaam 24
Therefore, those who  chant vedic Mantras, must utter OM first and then start Yagna, Daana(charity), and penance detailed in the scriptures.
Tadityanabhisandhaaya phalam
yagnah tapah kriyaah
Daanakriyaascha vividhaah
kriyamte mokshakaankshibhih 25 
The seekers of salvation are chanting TAT,  and are doing without expecting any returns, different Yagna, Daana, and Tapa(Penance),  with the firm view of ‘Each and everything is Parabrahman only’. 
Sadbhaave saadhubhaavecha sadityetatprayujyate
Prasaste karmani tathaa sachchabdah paardhayujyate  26
O Paarth, the word ‘SAT’ is the name of Parabrahman is utilized in the feeling of Supreme Reality, Supreme Good Karma and Eternal Truthfulness. 
Yagne tapasi daanecha stitih saditichochyate
Karmachaiva tadardheeyam saditye vaabhidheeyate 27
The state of stability in the higher rites of Sacrifice, Charity, and Penance, is also said to be SAT.  The rites that are performed for  the love of God and Karmas intended for God are also spoken of as SAT. 
Assraddhayaa hutam dattam tapastaptam krutamcha yat
 Asadityuchyate paartaha nacha tatpretyano iha            28
O Arjun, whatever Homam(sacrifice), Charity bestowed, austerity performed, or such other karmas, without any dedication, devotion, or faith, is said to be ‘Asat’. They will not yield any results either in this world or in other world. They are worthless.
Saktipaatam:
To bestow ecstatic union with God is called Saktipaatam.
This is possible to Great Masters like Baabaaji, Laahiree Mahaasaya, Sri Yukteswar Swaami, and Sri Sri Paramahamsa Yoganada samiji etc.
Sat is God beyond Creation. Its location is Sahasraarachakra.
Tat is the vibrationless God in Creation. Its location is Kootastha.  It is called Paraasakti.
Om is vibrational God in creation. It is called Adisakti.  He is direct cause of Creation.
Idea, Subtle, and Physical micro and Macro creations of  this body and Cosmos have been manifested because of OM vibrations.
Om is the Sound and Name of Parabrahman. This Pranava Sound will remove all faults/sins of the sadhak.  The real achievement of sadhak is to hear the OM sound within during sadhana. Om cannot be heard by the sadhak till the body attachment exists. 
Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                    Sraddhaatrayavibhaaga yogonaama saptadasodhyaayah(17th chapter)                           
   Aum, Tat, Sat.
Om SriKrishna ParaBrahmanenamah
                          Sri Bhagavadgita
             Atha Ashtadasodhyaayah(18th chapter)
                     Moksha sannyaasa yogah
Arjun uvaacha: 
Sannyaasastu mahaabaaho tattwamichchaami veditum
Tyagasyacha hrusheekesa pruthakkesi nishoodana   1
O Krishna, indweller, Vaasudevaa, I wanted to know what is sanyaasa, and what is Tyaga.
When sadhak feels that there is still some distance between him and Parabrahman during this Aatmabodha, Soul wisdom, then he will address Brahman with explicit adjectives such as ‘the conquerer of senses, and conquerer of Maaya’. He will pray Him to get him also out of this Maaya.
Sri Bhagavan uvaacha:
Kaamyaanaam karmanaa nyaasam sannyaasam kavayo viduh
Sarvakarmaphalatyaagam praahustyaagam vichakshanaah 2
Sri Bhagavan said:
O Arjun, doing all good and righteous Karma without thinking about its fruits of action is Sanyaasa. The learned declare that thyaga is the relinquishment of the fruits of activities.  That means do righteous Karma and then relinquish its fruits of action.
Without expecting the fruits and doing the righteous karma for the sake of Karma from the start is Sannyaas.
Doing the assigned righteous duties and then relinquishing the fruits of Karma is Tyaaga.
Sat means Eternal truth,  nyaasa means Quest.
Sannyasa means Quest for Eternal Truth. For this before the start itself of righteous karma one should do the righteous karma without expecting fruits.
Tyaga means do the righteous karma without expecting fruits.     
Tyaajyam doshavadityeke karmapraahurmaneeshinah
Yagnadaana tapah karmanatyaajyamiti chaapare     3
Some vedantis say that all Karmas are faultful and hence they are to be given up. But Yagna, daana, tapas, and righteous Karmas are not be abandoned.
Nischayam srunumetatra tyaage bharatasattama
Tyaagohi purushavyaaghra trividhah samprakeertitah  4
The best among Bharatas, and Purushas, O Arjun, first listen about Tyaaga among Sannyasa and Tyaaga.  Tyaaga is of three types, Saatwic, Raajas, and Taamasic.
Yagnodaana tapah karmanatyaajyam kaaryamevatat
Yagnodaanam tapaschaiva paavanaani maneeshinaam  5
Yagna, Daana, and Tapa karmas are not to be givenup. They create the sanctity to people. 
Etaanyapitu karmaani samgam tyaktwaa phalaanicha
Kartavyaaneetime paardha nischitam matamuttamam  6
Yagna, daana, Tapa, and bounden duties are also to be performed without any attachment, and fruits, is of my firm view.
Niyatasyatu sannyaasah karmanonopapadyate
Mohaattasya parityaagastaamasah parikeertitah        7
The relinquishment of dutiful actions mentioned in the scriptures is improper. To abandon them with ignorance is Taamasa Tyaaga.
Dukkhamityeva yatkarma kaayaklesa bhayaattyajet
Sakrutvaa raajasam tyaagam naivatyaagaphalam labhet   8
He who abandons the dutiful actions as assigned by scriptures, fearing that it may cause pain and tiredness to the  physical body, is performing Raajasic Tyaaga.
Kaaryamityeva yatkarma niyatam kriyaterjuna
SamgamTtyaktwaaPhalamchaivaSatyaagaassaatwikomatah 9
O Arjun, when scripture sanctioned dutiful actions  are willingly performed, without expecting fruits of action forsaking attachment,  with the view that they are aught to be done,  that renunciation is said to be SaatwicTyaaga
 The sadhak who gives up the trivial sense pleasures to get united with Brahman, he has entered into first stage of Saatwika Tyaaga. If this stage  leads to the renunciation of all fruits of Karma, in mind, action, and speech, and doing karma only for the sake of Parabrahman without any attachment, then the the sadhak is deemed to have been entered into the last stage. This real Sannyaasa.
When a sadhak is doing Kriyayoga sadhana, then he is surrounded by Aura, or he may be able to visualize Great Souls in his meditation. His advancement in sadhana not only depends upon these things but also more on how much endurance he has towards the worldly difficulties he encounters     
Nadwsehtya kusalam karma kusaalenaanushajjate
Tyaageesattwa samaavishto medhaavee chinnasamsayah 10
The remunciant with Saatwik qualities, intelligent, free from doubts, will not hate unpleasant karma and will not be attached to pleasant Karma.
Nahidehabhrutaasakyam tyaktum karmaanyaseshatah
Yamtukarmaphala tyaagee satyaageetyabhideeyate  11
For the embodied being, it is not possible to give up karma fully. Who is relinquishing the fruits of action is called Tyagee.  
When a  person leaves a rented house, and shifts to another rented house, he will not feel unhappy. Likewise the Tyaagi, renunciant, also should feel that I am living in the House of Brahman.  He will give up body attachment, and do karmas only for the sake of Brahman.  He will not expect the fruits of his actions.  He will not lament for transmigrating from one body to another body.
Chakradhyaana:
Sit erect in Vajrasana, Padmasana or Sukhaasana with Gnaana Mudra. Face East or North. Get relaxed. Keep the neck and spinal cord straight. Fix the gaze in Kootastha.  Sit in a chair. The feet should be kept such as to touch the ground. There should be insulation between the ground and the feet. It is advisable to sit with socks.
Sit in superconscious level bending the neck back. Now do kriyayoga from Mooladhaarachakra to Sahasrarachakra, and from Sahasrara to Moolaadhaara, learnt from a sadguru or from a Sadhak well proficient in Kriyayoga.
One breath in + one breath out = one Hamsa.
Ordinarily normal healthy man does 21,600 Hamsas per day. This amounts to 15 Hamsas per minute.
If a person does 15 Hamsas per minute, then he is said to be Bhogi.
If a person does less than 15 Hamsas per minute, then he is said to be Yogi.
If a person does more than 15 Hamsas per minute, then he is said to be Rogi, patient.
Tortoise does very few Hamsas per day and hence it lives more than 1000 years if it is not killed by somebody.
Sadhak also will increase his healthy life span by doing Pranayama with control of life force.  He will gradually get united withBrahman.
The chakras in the spinal cord are like Junction boxes. The Cosmic consciousness enters Sahasrachakra through Medulla. From there it enters Aagna, Visuddha, Anaahata, Manipura, Swadhistaana, and Moolaadhaara chakra.  From these Junction boxes, the cosmic consciousness enters into nerve centres, nerves, and organs, in required magnitude.
The sleeping Kundalinee power will have its hood nearer to Moolaadhaarachakra and its tail up in the higher chakras.  The sadhak will awaken the sleeping Kundalinee power underneath the  Moolaadhaarachakra.  His advancement in sadhana is proportional to the kundalinee touching the chakras.
This Kundalinee force is called Draupadi in Mahabhaarata, Sita in Ramayana, and Padmavati in Sri Balaji Venkateswara Swami charitra.  
 This awakened kundalinee power crossing Moolaadhara, Swaadhishtaana, Manipura, Anaahata, and Visuddha, is what is called Draupadi marrying Five persons.    
Anishtamishtam misramcha trividham karmanah phalam
Bhavatyatyaaginaam pretya natu sannyaasinaam kwachit 12
The three types of fruits of Karma—good, bad, and mixture of good and bad, are tagged to the non renunciants of Karma after the fall of the physical body. The renunciants will not be tagged with these karmas.
Panchaitaani mahabaaho
kaaranaani nibodhame
Saamkhye krutaamte proktaani
siddhaye sarvakarmaanaam                13
O, the mighty armed Arjun, learn from Me the five causes for the performances of all Karma. These are chronicled in the Saamkhyasaastra wherein all Karma ends.
Man has to overcome three types of difficulties, Physical, mental, and spiritual. 
Adhishtaanam tathaa kartaa
karanamcha pruthagvitham
Vividhaascha pruthakcheshtaa
daivam chaivaatra panchamam                  14
To perform Karma five things are required. They are:
1)Body, (2)the doer, (3) different senseorgans, (4) different abjects of senses, and (5)God.
1)Here body means Physical body. 2)Karta means Man, 3)his senses, and 4)objects of senses.  and 5)lastly the God is mentioned.  That means self is of primary importance. That is why man should trust his will power provided by the God.
 Sareeravaamgmanobhiryatkarma praarabhatenarah
Nyaayam vaa vipareetamvaa panchaitetasya hetavah  15
When man contemplates any karma with body, speech, and mind—with or without scriptural authority—then these five are the causes.
Tattraivam satikartaara maatmaanam kevalayam tu yah
Pasyatyakrutabuddhitwaanna sa pasyati durmatih     16
When these five are the causes to do karma, then the man who thinks that the Soul is the real Karta, doer, is said to be ignorant. He is not knowing the real nature of Soul.
Yasyanaaham krutobhaavo buddhiryasyanalipyate
Hatwaapi sa imaan lokaannahanti na nibadhyate      17
Who thinks that ‘Iam not the doer’, whose mind is not entangled in worldly things and actions, such aperson even if he destroys all these worlds cannot be deemed as destroyer. .he will not be besmeared with Karma, and sins.
If we reduce the salary of an employee of a house hold, he will unabashedly search for another house where he will get more pay. He will not have any affection towards the house hold where he has been working for the past several years. Likewise man should surrender all his karma to God thinking  that he is doing everything for the sake of God only without ego.
Gnaanam gneyam parignaataa trividhaa karmachodanaa
Karanam karmakarteti trividhah karmasamgrahah    18
For karma—the knowledge, the known and the knower—is the triune stimulus.  Likewise, the instrument, action, and the doer, are thre threefold basis of action.
Gnaanam karmacha kartaacha tridhaiva gunabhedatah
Prochyate gunasamkhyaane yathaavachchrunataanyapi 19
In saankhya also it is said about the knowledge, karma, and the doer are of  three types according three qualities, sattwa, Rajas, and Tamas. Iam rendering to you as per Sankhya sastra.  Listen carefully.
Sarvabhooteshu enaikam bhaavamavyayameekshate
Avibhaktam vibhakteshu tattgnaanam viddhi saatwikam 20
O Arjun, the indestructible unique Spirit is existing in all the things, animated or inanimated, without any division. Who so ever understands this, his knowledge is said to be saatwik.
 The look alike light particles and rays jetting from a cinema projector through the film strike the silver screen and will transform into several visual figures.  Likewise in sadhana, the sadhak who has reached the highest state of transcendecy, will perceive that the Consciousness of one Brahman appears to be transforming into several forms due to the influence of Maaya.           
Pruthaktwenatuyagnaanam naanaabhaavaanpruthagvidhaan
Vettisarveshu bhooteshu tatgnaanam viddhi raajasam    21
The indestructible Spirit is existing differently in different beings. The man with this knowledge is Rajasic.
The sadhana Gnaan which has not yet got rid of the sadhak is known as Raajasa gnaan.
The advent of self-knowledge through renunciation of all actions, as outlined in the sankhya philosophy, and the cosummation of all actions after attaining this realization, as described in the Vedanta, both have to do with the complex nature of Karma. Karma is the outward expression or manifestation of the transcendental spirit and its reflection, the soul, through the instrumentality of Nature and the faculties of the body.
Sankhya teaches that renunciation of all Karma is necessary in ordwer to gain self-knowledge.  The first rule or aphorism of Sankhya declares that the highest necessity of man is the eradication of physical, mental, and spiritual suffering at the root, so that there is no possibility of recurrence. Yoga philosophy teaches the technique by which three fold human afflictions are removed forever.
Vedanta means end of the Vedas(complete knowledge of all truth to be known) describes the Ifinite spirit, the ultimate goal of man. The first sootra of Vedanta: athato Brahma jignaasaa. So begins the inquiry about the Brahman, the infinite.
Without the renunciation enjoined in the Sankhya, and without the twechnique of the Yoga, the devotee cannot escape the misery producing entanglements of physical consciousness and realize the Infinite.
Both Sankhya and Yoga teach how to attain Brahman.
Vedanta describes and descusses what is to be found by following the advice of Sankhya and,  most important, by practicing the techniques of Yoga. 
All three philosophies point out the same goal, but Sankhya and Yoga must be followed first, for without their aid Spirit remains unreachable and unknown. Only after one has realized Brahman does the Vedanta discussion about Him become truly meaningful.
All human activities  are consummated when by following the principles of Sankhya and Yoga when by following the principles of Sankhya and Yoga the devotee reaches the ultimate state described by Vedanta; oneness with the Absolute, beyond the domain of all activities.
Yattu krutsnavadekasminkaarye saktamahaitukam
Atattwaardha vadalpam cha tattaamasamudaahrutam 22
This body is the natural result of man woman relationship, and everything is Physical thing(s) only, the knowledge that causes  the interest only in physical things, illogical, meaningless, lacking conformance with the principle of truth, mean, trivial, and preposterous, is Taamasic knowledge. 
The one who does not do any yoga sadhana at all is considered to be gnaana of  fully ignorant Taamasic person.
Niyatam samgarahita maraagaadweshatah krutam
Aphalaprepsunaakarma yattaatswaatwikamuchyate    23
The karma that is Sanctioned by scriptures, tke karma done without expecting any returns, without any attraction or repulsion, is said to be Saattwika Karma.
The karmas of advanced Kriyayogi will be as above. The saatwika yogi will do the Poojas, worships, without expecting any fruits of his worships.
If a snake is killed by a Yogi without any hatred on the snake to save the child who was about to be bitten, he will not be touched by sin. Man is supposed to be having six senses including Mind. As such he is superior being compared to the snake which is lower being.  Man, the higher being, can breed the lower beings, but not vice versa.
Yattu kaamepsu naakarma saahamkaarenavaapunah
Kriyatebahulaayaasam tadraajasamudaahrutam         24
The  karma which is done with expecting fruits, with egoitism, with more effort, is called Raajasa karma.
The poojaas, worships, done for the sake of reputation, and not for the love of God, is said to be Raajasic Poojaa.
Anubandham kshyam himsaa manapekshyacha paurusham
Mohaadaarabhyatekarma yattattaamasamuchyate         25
The karma which is performed with ignorance not considering the good or bad results, the harm, torture, ability, is said to be Taamasik Karma.
Muktasamgonahamvaadee dhrutyutsaahamanvitah
Siddhyasiddhyornirvikaarah kartaa saattwika uchyate  26
The man who has shed fruits of karma, not having ‘Iam the doer’ type of egotism, attachment, the man who does the work with courage, and interest, who do not feel pleasantness or unpleasantness in case of success or no success, is said to be Saatwika karta.
The wife of some one came running and told her husband that their only son died due to some sudden accident.  Husband says, ‘Do dhyana quietly for some time for the peace of the departed soul’ to his wife.  He thanks the God for giving twenty years’ company of  a good God fearing son  who was a very good Kriyayogi.    
Having heard this, the wife says, ‘don’t you have any sorrow for the departed soul? ’
I had a dream last night, ‘I became a king, I had three sons. My palace was uprooted and all my sons were killed due to an earth quake.’ Now you tell me, my dearwife, ‘shall I have to wail for the mishap of that dream in which there was a colossal loss, or  shall I have to wail for this one son who is lost in the dream of Parabrahman?’     
Rageekarmaphalaprepsu lubdhohimsaatmakosuchih
Harshasokaanvitah kartaa raajasah parikeertitah    27
The man who do work with affection, and attachment towards relations etc, who is interested in fruits of karma, who is greedy, torturing quality, impure, and who is subjected to pleasantness, and unpleasantness, is said to be Raajasa karta.
Ayuktah praakrutah stabdhah satonaishkruti kolasah
Vishaadee deerhasootreecha kartaataamasa uchyate  28
The man with vacillating mind, ignorant, untrained, foolish, and conscienceless, who causes harm to others without any valid reason, always immersed in useless thoughts, idle, and who take more time for small work, is said to be  Taamasa karta.
Buddherbhedam dhruteschaiva gunatactrividham srunu
Prochyamaanamaseshena pruthaktwena dhananjaya     29
O Arjun, I will explain to you now separately and in detail about the threefold difference of Buddhi(intellect) and Dharma in accordance to Gunas.
Pravruttimcha nivruttimcha
kaaryaakaarye bhayaabhaye
Bandham mokshamchayaavetti 
buddhissaapaartha saatwikee             30
O Arjun, that Buddhi is Saatwic which correctly perceives the paths of adhering to Dharma and detachment to Adharma, dutiful and undutiful actions, fear and fearlessness, and bondage and liberation, is said to be Saatwika Buddhi.   
Yayaadharmamadharmancha kaaryamchaakaaryamevacha
Ayathaavat prajaanaati buddhissaa paartha raajasee      31
O Arjun, the Buddhi which cannot perceives the real Dharma and Adharma,  dutiful karma  and undutiful Karma, is said to be Raajasa Buddhi.
Adharmam dharmamiti
 yaamanyate tamasaavrutaa
Sarvaardhaan vipareetaanscha
buddhissaa paartha taamasee                   32
The Buddhi covered with ignorance, sees the Dharma as Adharma, likewise all the other matters in a perverted way, is said to be Taamasic Buddhi.     
Dhrutyaayayaa dhaarayate manah praanendriyakriyaah
Yogenaavyabhichaarinyaa dhrutissaa paartha nsaattwikee 33
O Paarth, the courage with which a man maintains his consistency of mind not turning towards sense pleasures, the courage with which he controls the life force, senses, and the acts or objects of senses, with Kriya yoga sadhana, and steadily keeps his mind fixed to Soul meditation, such courage is Saatwika courage.
Yayaatu dharmakaamaarthaan dhrutyaa dhaarayaterjuna
Prasangena phalaakaamkshee dhrutissaa Paardha raajasee 34
O Paarth, the fortitude with which the man follows Dharma, riches, and desires, longing for the fruits of Karma, is said to be having Raajasa Dhairya, Raajasa courage.
Yayaaswapnam bhayam sokam vishaadam madamevacha
Navimunchati durmedhaa dhrutissaa paartha taamasee   35
O Paarth, that resolute fortitude with which the gullible does not forsake over-sleep, fear, sorrow, despair, and wanton conceit, is said to be having Taamasic Dhairya.
Sukham twidaaneem trividham srunume bharatarshabha
Abhyaasaadramate yatra dukkhaantam cha nigachchati 36
O the best of Bharatas,  the practice with which the sadhak gets happiness, and unhappiness, that also is of three types. Listen to Me now in detail. .
Yattadagre vishamiva parinaamemrutopamam
Tatsukham saatwikam proktamaatmabuddhiprasaadajam 37
The happiness which is like poison in the beginning and like nectar in the end, such transcendent happiness gained due to the purity of mind and intellect is called Saatwika sukha.
In the initial stages of sadhana, the sadhak will have pains of Physical body. Then the subtle body will be subjected to thought disturbances. After this phase, the idea body will be subjected to certain problems like levitating effects etc.   All these are natural but appear like poision in the beginning, but in the end they will transform into unparallel happiness of meeting God which is like nectar.
Vishayendriya samyogaadyattadagre mrutopamam
Parinaame vishamiva tatsukham raajasam smrutam    38
The happiness that appears to be nectar in the beginning because of conjunction with senses, and poison at the end, is said to be Raajasa sukha.
Man has to control his senses. If he tries to satiate the senses more than requirement without any control, then he has to suffer afterwards.
Yadagrechaanubandhecha sukham mohanamaatmanah
Nidraalasya pramaadoddham tattaamasamudaahrutam 39
The elusive happiness that springs from over-sleep, idleness, and miscomprehension; the attachment, ignorance, and delusion which are the results of these in the end cause unhappiness. So the happiness which causes unhappiness in the beginning and end is said to be Taamasic sukha.  
Natadasti pruthivyaam vaa divi deveshu vaapunah
Sattwam prakrutijairmuktam yadebhissyaattribhirgunaih 40
Nothing in this world or in the world of Devas, that is not born out of this Prakriti or Maaya,  with one or more of these three Gunas exists.
Braahmanakshatriyavisaam soodraanaam cha paramtapa
Karmaani pravibhaktaani swabhaava prabhavairgunaih 41
O scorcherer of enemies, the duties of Braahmins, Kshatriyas, Vaisyas, and Sudras, are allocated as per the gunas springing forth from their own nature. 
The true natural castes are the Brahmins or God-knowers, Kshatriyas or sense fighters, vaisyas or wisdom-cultivators, and Sudras or body-identified individuals.
These four castes are present in all nations as the spiritual intelligentsia; the soldiers, rulers, and leaders; the businessmen ; and the laborers.
The traits such as Saatwika, Raajasa, Taamasa, Saatwika + Raajasa, Raajasa + Taamasa, lead to castes.
Dronacharya is Brahmin. He is the Guru of Paandavas, and Kauravas. He taught them archery etc which are not Brahmin traits. If father is a Doctor, then his son need not be a Doctor. The caste should not be based on biological birth i.e., on the caste of father.  This leads to the disintegration of the Nation.   
Samodamastapah saucham
kshaantiraarjavamevacha
Gnaanam vignaanamaastikyam
braahmam karma swabhaavajam       42
Mind control, Sense control, Tapas or self discipline, purity within and without, Kshaanti or excusing the faults of others with good heart,  tenderness in behaviour with mind and senses, straightforwardness without conceitedness, possessing scriptural knowledge, faithfulness towards Eeswar, the Parabrahman, Astral worlds, God, Sadguru, the preceptor, are the  Brahmin Karma, duties, by nature.
Sauryam tejo dhrutirdaakshyam
yuddhechaapya palaayanam
Daanameeswarabhaavascha
kshaatram karma swabhaavajam   43
Valor, radiance, fame, glory, courage, ability, not fleeing from battle, munificience, administrative capacity, are  Kshatriya karma by nature.  
Krushigoraksha vaanijyam vaiswam karma swabhaavajam
Paricharyaatmakam karma soodrasyaapi  swabhaavajam 44
Cultivation, cow breeding, business, are Vaisya Karma by nature.
Seva or service to others is the Sudra Karma by nature.   
Swe swe karmanyabhiratas samsiddhim labhate narah
Swakarmaniratassiddhim yathaa vindati tachchrunu 45
The man who is dedicated to his natural karma shall gain gradual ability to ascend transcendency.  How the man devoted to his natural karma shall gain utmost success—let me detail.     
Yatah pravruttirbhootaanaam yenasarvamidam tatah
Swakarmanaa tamabhyarchya siddhim vindati maanavah 46
The Brahman from whom all beings are manifested, He by whom the whole world is pervaded, such Brahman is to be worshipped by his natural Karma. This gives him perfection of  wisdom.
If studied with dedication, then he can become a Doctor or Engineer irrespective of his caste. 
One will be able to remember and understand the lessons if he reads once or twice as per his past habits.  In case of others they may have to read more than once because he has not done much home work in his past births.  One should make more hardwork with will power to remember and understand the lessons without bothering about the past habits.
Sreyaan swadharmo vigunah paradharmaatswanustitaat
Swabhaavaniyatam karma kurvannaapnoti kilbisham 47
It is better to follow one’s own natural Dharma in spite of lacking merit, than following Dharmas of others. He who performs his natural Dharma cannot contact sin.
Man can never be able to satisfy the senses. Man should come out of the bondage to senses with Kriyayoga sadhana and worship the Soul which is beyond all Gunas. This is called Swadharmaacharana and it is the best.
Kriyayoga is scientific, unwavering, and gives fixed results for sure which leads to merger of self with Spirit. This merger is called Yoga. Religion is based on superstious beliefs and chisms..  Kriyayoga is beyond religion. 
Sahajam karmakaunteya sadoshamapinatyajet
Sarvaarambhaahi doshena dhoomenaagnirivaavrutaah  48              
O son of Kunti, one should not give up natural Karma even though it has some imperfection.  Agni is covered by smoke. Likewise all karmas are covered by one blemish or the other.
In spite of getting physical, mental, and spiritual difficulties in the initial stages, one should not leave sadhana.  With Kriyayoga meditation the sadhak will unite the small happiness of self  with infinite happiness of Spirit.
Meditation is not an ordinary concentration.
Concentration means to remove the mind from unwanted things and make it to concentrate on a thing of interest.
To liberate the mind from restlessness amd make it to concentrate on God only by special technique(s) is called meditation. So meditation is God knowing concentration.
Aasaktabuddhisarvatra
jitaatmaa vigataspruhah
Naishkarmya siddhim paramaam
sannyaasenaadhigachchati 49
The man who is not attached to worldly things, and passions, who conquered the mind, desireless being, is victorious in gaining his soul due to detachment.
The intense meditation if it is done for a longer time, then sadhak will be able to get beatitude of God happiness for a longer time in silence.
Every sadhana of yesterday should be more intense than today. Likewise dhyana of  tomorrow should be more intense than today.    
Siddhim praapto yadhaa brahma tathaapnoti nibodhame
Samaasenaiva kaunteya nishtaagnaanasyayaaparaa    50
O son of Kunti, listen to Me in brief, about the personification of Gnaana state, pure wisdom, the renunciation of Karmas for gaining Supreme Brahman. 
Buddhyaavisuddhayaayukto
dhrutyaatmaanam niyamyacha
Sabdaadeenvishayaastyaktwaa
raagadweshau vyudasyacha     51
viviktaseveelaghvaasee yathaavaakkaayamaanasah
dhyaanayogaaparonityam vairaagyam samupaasritah    52
ahamkaaram balam darpam kaamam krodham parigraham
vimuchyanirmamassaanto brahmabhooyaayakalpate      53
The man who is absorbed in completely purified Intellect, who takes the easily digested limited Saatwika food, the man who sits in solitude giving up the senses, and objects of senses,  sits in clean place,  who has controlled his body and mind by harmonizing Antahkarana with the power of Yoga Dharana, concentration,  the sadhak who has taken shelter in fortified vairagya, dispassion, by shedding attractions and repulsions, who has given up ego, brutal strength, vanity, lust, anger, and possessions, always immersed in Dhyana, and who has given up ‘I and mine ’consciousness is qualified to become one with Brahman. 
Kriyayoga sadhana is the only powerful weapon by which Maaya can be defeated and makes the sadhak united with God.       
Brahmabhootah prasannaatmaa nasochati nakaankshati
Samassarveshubhooteshu madbhaktimlabhate paraam 54
The sadhak whose mind is calm and pure, who is one with Sat Chit Ananda Parabrahman, and who is Jeevanmukta will not lament and ask about anything. Equating himself with evry being and seeing those things within him shall get transcendental devotion in Me.
The principal things have to be given first importance. Man should do meditation immediately.  Then the worldly things will not bind us.  The day started with meditation will end happily.  Again meditate before sleep.  Even if you get five minutes free time in this madding crowd, meditate intensely.
Give up gossping and do meditation.  The worldly life should be sandwiched between one meditation to another meditation.
Bhaktyaamaamabhijaanaati yaavanyaschaasmitattwatah
Tatomaam tattwato gnaatwaa visate tadanantaram 55
With this supreme devotion the sadhak is anchored to Brahman. Then he is understanding really ‘Me and My capacaity, ’ and afterwards entering into Me.
Even if lesser time is available, then that time must be made use of. The sadhak should do meditation so intensely that he should get the feeling of having done meditation for hours together. 
Sarvakarmaanyapi sadaakurvaano madvyapaasrayah
Matprasaadaadavaapnoti saaswatam padamavyayam  56   
The yogi who gives up the feeling of ‘I am doing ’, the relinquisher of all results of Karma,  and who is completely dedicated to Me, is getting the eternal salvation with My grace inspite of doing all karmas.
Chetasaa sarva karmaani mayisannyasyamatparah
Buddhiyogamupaasritya machchittassatatambhava  57
You surrender all your karma with fully devoted mind to Me.  You trust Me as a supreme goal.  Completely absorb your Buddhi in Me with the adoption of Dhyanayoga(meditation).
If we do more Dhyaana then we will be able to help more to the people. We will make unision with God. we will become selfless. We will know our universality.
Machchittassarvadurgaani matprasaadaattarishyasi
Athachettwamahamkaaraannasroshyasi vinakshyasi 58
If you completely absorb your mind in Me, then you can cross this circuit of unpleasant mundane circuit with My grace. If you do not adher to My advise due to ego, then you will be spoiled.
Why God should appear to us so easily? We work very hard for the sake of money, spouse, or offspring. But we will not make any efforts to know about all providing God. If we do at least one hour regular intense meditation with single pointedness of getting Him, then He will definitely appear to us.   
Yadyahamkaaramaasritya nayotsya itimanyase
Mithyaisha vyavasaayante prakrutistwaam niyokshyati 59
In case if you say ‘I will not fight’ with ego, your effort will be fruitless. Because your kshatriya nature will force you to do war.  
Intuition will come within and thoughts will come from without.
The intuition will make the sadhak to see the Truth practically in his front.

Sadhana is a war. Every sadhak is warrior, kshatriya, who makes battle with enemies within and without.
Thoughts will make the man to understand the things indirectly. The intuition will make the sadhak to see the truth fully in consummation directly with unforgettable experiences.    
Every human being has thoughts as well as intuition, sahajaavabodha.  As you increase your thoughts you can increase the intuition, Soul wisdom. Intuition is beyond logic.
Swabhaavajenakaunteya nibaddhaswenakarmanaa
Kartumnechchasi yanmohaat karishyasya vasopitat    60
O Arjun, bound by your own habits of past births culnminating in  your present kshatriya nature, the battle which you do not want to do now will be done by implication of Karma.
Infinite God is beyond logic. The logic can grasp cause and effect theory. God is beyond cause and effect theory. The greatest faculty man has got is Intuition but not intellect. Intuition is the most powerful weapon man only has got.  The knowledge the man gets out of the senses is defectful. Delayed, and discredited one.  Intuition given by God shall provide immediate truth about the things.
Eeswarassarvabhootaanaam hruddeserjuna tishtati
Bhraamayan sarvabhootaani yantraaroodaanimaayayaa  61
O Arjun, the Organizer of Cosmos, Parabrahman, is lodged in the hearts of all creatures.  His Cosmic delusion, Maaya, bracing all beings to rotate as if attached to a machine.
The superconscious mind is the centre of mind and intellect. Man can find God through this superconscious mind only. Man can overcome Maaya through meditation only.  The happiness that the sadhak will get during and after meditation, will reveal the all pervading bliss.
The subtle light which causes this apparent world is the same light that apeears to the sadhak in his sadhana.  The sadhak who sees that light will experience universal consciousness.
 Tamevasaranam gachcha
 sarvabhaavena  bhaarata
Tatprasaadaatparaamsaantim
 sthaanampraapsyase saaswatam 62
o Arjun, take shelter in Parabrahman who is the indweller of all hearts in all ways. With His grace you can get the utmost peace, and Eternal shelter.
The saadhak should abandon body attachment and slavery completely.  Till the sadhak attains the mastery, this body attachment is his enemy.   Except spreading the message of God, and singing His glory with unflinching faith, nothing else he desires.  Complete surrender to God is the only way to obtain His love. Kriyayoga is the path for this by which the wavering mind can be controlled.
Ititegnaanamaakhyaatam guhyaadguhyataram mayaa
Vimrusyaitadaseshena yathechchasi tathaakuru         63
I have granted you the most secretive, and the transcendental wisdom, this way.  You grasp this the most valuable wisdom fully, and then follow whatever way you like.
Sarvaguhyatamambhooyah srunumeparamam vacha
Ishtosi me drudamiti tatovakshyaami te hitam        64
O Arjun, listen to secret of secrets of My word once again.  You are very dearer tome. That is why I am once again telling you wishing your welfare.  
Manmanaabhava madbhakto madyaajeemaam namaskuru
Maamevaishyasi satyam te pratijaane priyosime       65
Concentrate Your mind on Me.  Devoted to Me only. Worship Me only. Put Namaskaar to Me. If you do this then you will get Me. You are dearer to me.  I am really telling you with promise.
Sarvadharmaan parityajya
maamekam saranam vraja
Ahamtwaam sarvapaapebhyo
 mokshayishyaami maasuchah 66       
forsaking all other Dharmas, take shelter in Me only. I will liberate you from all your sins.

The sadhak should give up all the duties of senses and surrender to God fully.  Then all the problems of Sanchita(past), Prarabdha(present), and Aagami(Future) karmas will be annihilated.
 Idamtenatapaskaaya
 naabhaktaaya kadaachana
Nachaasushrooshave vaachyam
nachamaam yobhyasooyati               67         
The one who do not do any penance, to a devotionless person, the one who do not want to listen to this Gita, the one who is having fault look of understanding, is not to be taught this Gita Saastra preached to you by Me.
Yaimam paramam guhyam
madbhaktweshyabhidaasyati
Bhaktim payiparaam krutwaa
maamevaishyatya samsayah       68     
The one who preaches or imparts this most secretive, and unparalleled Gita sastra to my devotees, then such person will have utmost devotion to Me, is getting Me undoubtedly having got his removed all his doubts.
Nachatasmaanmanushyeshu kashchinme priyakruttamah
Bhavitaa nachame tasmaadanyah priyatarobhuvih    69
No one among the men will be superior to him as he is doing more likable things to me.  that devotee  is more dearer to Me and no other such devotee exists on the earth. 
Adweshyatecha imamdharmyam samvaadamaavayoh
Gnaanayagnena tenaaha mishtassyaamitimematih      70
This conversation between you and Me is the embodiment of Dharma, righteousness. In my view who so ever studies this sacred conversation will be worshipping Me by Gnana Yagna, Pure wisdom sacrifice.  
Sraddhavaananasooyascha
 srunuyaadapi yo narah
Sopimuktassubhaan lokaan
praapnuyaat punyakarmaanaam 71

The individual will hear this Gita Sastra with dedication and devotion, then such devotee will be devoid of sins and will attain the world of virtue.
Kachchidetachchrutam paardha twayaikaagrena chetasaa
Kachchidagnaana sammohah pranashtaste dhanamjaya 72
O Arjun, did you listen to my Preaching with singleminded concentration? Has your illusion-born ignorance is completely mitigated?
Arjuna uvaacha:
Nashtomoha smrutirlabdhaa twatprasaadaanmayaachyuta
Sthitosmi gatasandehah karishyevachanam tava           73
Arjun said:
O Krishna, my illusion is annihilated with Your kind Grace. I had regained my wisdom consciousness. Doubts are mitigated. I am firmly established. I will execute Your orders.   
Samjayauvaacha:
Ityaham vaasudevasya Paardhasyacha mahaatmanah
Samvaadamimamasrausha madbhutam romaharshanam 74
Sanjay said:
O king Dhritaraashtra, this way I have heard the sacred and hair raising conversation between Srikrishna and the Great Soul Arjuna.
Vyaasaprasaadaat chchrutavaane dguhyatamam param
Yogam yogeswaraatkrushnaatsaakshaa kthayatasswayam 75
Through the grace of Maharshi Vedavyaas, this most secretive, the most pre eminent, and the supreme Yoga saastra has been bestowed on me, I have heard this sacred conversation between Arjun and Srikrishna, Yogi of Yogis,  directly.  
Raajan samsmrutya samsmrutya samvaadamimamadbhutam
Kesavaarjunayoh punyam hrushyaamicha muhurmuhuhu 76

O king Dhritaraashtra, Iam rejoicing again and again recollecting this astonishing, virtuous, and extraordinary sacred Srikrishnaarjuna conversation.
Tachcha samsmrutya samsmrutya rppoamatyadbhutam hareh
Vismayome mahaan raajan hrushyaamicha punah punah  77
O king Dhritaraashtra, recalling again and again the colossal manifestation of SriKrishna, I am stuck with wonder and overwhelming  joy.
Yatrayogeswarah krushno yatra paatro dhanurdharah
Tatra sree rvijayobhootih dhruvaa neetirmatirmama 78
This is my firm view that wherever the Lord of Yoga, Srikrishna, and bow wielder Arjuna, are present, there exist all victories, all fortunes, and  firm morality. 
Gaandeev = spinal cord.
The sadhak who do meditation  with  spinal cord erect will be rewarded with all victories, all fortunes, and endowed with unflinching morality. That is the sadhak who is triumphant over his self shall be bestowed with all righteous things.  


  
Om tat Sat iti Srimadbhavadgeetaa soopanishatsu Brahmavidyaayaam yoga Sastre Sri Krishnaarjuna samvaade                    Mokshasannyaasa yogonaama Ashtadasodhyaayah(18th chapter)                           
   Aum, Tat, Sat.






              

























             






             



Comments

Popular posts from this blog

Mantrapushpam with Telugu meaning మంత్రపుష్పం

49 Maruts mentioned by Sri Sri Yogiraj LahiriMahasya Maharaj

video వేమన ఒక క్రియాయోగి